CAZyme Information: PPTG_17185-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_17185-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	KI669627|CGC1	44801.19	4.9813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669627:156277-157536(+)

Full Sequence      

MVWRVCALAAAVTVSVVQAGPLPTGICYAPWHHPTVTYDVVGKDLTQVSQYFSSIRTFQT
LFSGVNVINSAAAAGIKVAVGVQLTDPALIDAEIKAVCEGYKANPSAVEAVYVGNENLKN
KDFGTFTADQLVGYITRVKECVGKTPVGSVQRINEWLSAEGAATLSAACDVIGVNIYPFF
TNGPQTAVEKLQTQWEQMAVKYDADKMHVTETGWPSEGENYGANAPSIEGMQKYLDDYVE
WSKNVPQSYWFMMYDTTVSYTGAEYEKHFGVFTSDGKQKITVPSGDGAQKQSNATDASPT
QQKQPNVSADPPATVKSKDTPANKTAGATSTPVYTFQQDNTGNEAGTVAPFSERDSGTCS
QIVSSGDAAVGIKIVTDKTCASGGVGCLDKICRYCKEVSTTQSSKFVDCASIEGKSRKL

Enzyme Prediction     

No EC number prediction in PPTG_17185-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	279	4.4e-20	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.12e-22	23	275	45	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.05e-06	209	282	231	307	Glycosyl hydrolases family 17.
311610	Glyco_hydro_53	3.19e-04	170	250	200	295	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	0.001	170	250	246	340	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21797.1|GH17	9.49e-123	16	286	565	837
UPT50359.1|GH17	4.96e-118	15	283	19	288
UIZ21931.1|GH17	2.01e-71	8	283	10	288
UIZ21795.1|GH17	1.61e-53	8	195	10	200
CCA18992.1|GH17	4.83e-49	25	292	22	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.38e-12	25	285	39	297	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	8.58e-10	66	282	68	303	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|A1DBG6|BTGE_NEOFI	1.77e-08	25	226	297	503	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|P43070|BGL2_CANAX	2.12e-08	66	282	68	303	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P53189|SCW11_YEAST	9.49e-08	23	237	281	508	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q04951|SCW10_YEAST	1.27e-07	25	275	138	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999762	CS pos: 19-20. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in PPTG_17185-t26_1-p1.