CAZyme Information: PPTG_16828-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_16828-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	KI669619|CGC1	89033.13	5.2820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669619:264808-267189(-)

Full Sequence      

MLHSSPKPHRSGEVHPLLETNSAPLSQSQSSSTNRISRWSVLAIVSTLLFAAAVFGIFKP
SVSTLRSATTVAPDAKFDLFTPIFNSEAPPQSLFNHTDAHKNLLPPKFLAPGLIGSRPIP
TNDWWGNMIGATVGEEEVVHPVWTNPYSVTPSIFMEPYGLTMNYPYTTRLFGGGLTGNGD
AEMYYLHGQIPEFTFSATEFSNSSHPIFEVFDWDDLTVQLRFLSREDSSKKFEATLASGM
AFVTAHYSGLTPRFQTYYNISSINGLDATETVDLPLTNDRYVLQFNNGATWTLYFSNEVT
LRFDGHSTLDMEKPFTGIARVALIPDASAQEQIIFDQTASCVLNGGRVEAHNEDAYAYKW
QTSGDCTNGMLHYAQVHHVDTLDRRYAIEAEGVAAHSTTRGLMQGIVTKTSPPEWRMMET
VDFPVDFYPPRKPDASVVKAYEMKKNLIADIDSEWSIALGQSYYFNGKAAQKYASLCLMA
GDSSIVGDDTELLSHCITKLEGLLTPFLNNTWTNPLDYDTIYRGIVSSQGFKLNDPNVDF
GNTMYNDHHYHYGYWVVTAAIVNKLDPTWSGIPAMNRMAGFMIRDVANPSDADPYFPKFR
SLDWYRGHSYSHGITALGDGKDEESTSEDMNFYYGMTLLGKVTGDKHLETVGKLMVKLNA
RAIQTYFLLEDGNRAHPDRYRDNKVMGILFDNKVNYATWFSGEKHAIHGIQMLPATAVTE
FVRTLNFVEQEWDQILAREDIVLNDNQTNPWLSLLYMNYATVNKDFALEKLRTVTMDDGL
SRSWAMYIAATRP

Enzyme Prediction     

No EC number prediction in PPTG_16828-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	116	787	2.1e-176	0.9710610932475884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	5.90e-143	462	786	30	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.28e-140	45	790	29	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.68e-45	104	426	3	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	0.0	1	793	1	793
UIZ20868.1|GH81	3.67e-247	84	791	85	791
UIZ20872.1|GH81	7.36e-247	84	791	85	791
UIZ20875.1|GH81	7.36e-247	84	791	85	791
UIZ20873.1|GH81	1.48e-246	84	791	85	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	4.61e-115	48	793	5	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	4.88e-115	78	793	7	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	1.57e-111	78	793	7	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.83e-28	119	783	35	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.95e-26	118	780	48	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.44e-96	82	790	14	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.71e-92	107	790	86	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	9.41e-91	60	786	59	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	3.00e-88	118	790	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.11e-83	106	786	421	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000031

TMHMM  Annotations     

Start	End
36	58