CAZyme Information: PPTG_16277-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_16277-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
105	KI669616|CGC6	11188.55	6.4514

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669616:429179-429496(+)

Full Sequence      

MVWLQAIGGAGPLSNTGKPIKEVNVGGVDFSLYHGKNGNMTVYSFVAANTTNSFSTDFKQ
FFDELPANNSIAPEQYLINVQAGTEPFVGNGKLTVSKYSAAVHTV

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	1	102	1.1e-27	0.6730769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	1.58e-20	1	102	106	206	Glycosyl hydrolase family 12.
235746	PRK06215	1.71e-05	1	59	138	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22026.1|GH12	2.03e-59	1	104	139	242
ABB22027.1|GH12	5.28e-48	1	103	139	241
ABG91065.1|GH12	1.56e-45	1	104	139	243
ABB22034.1|GH12	2.15e-45	1	103	137	240
ABB22025.1|GH12	2.88e-43	1	104	138	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	5.35e-33	1	102	140	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	8.13e-31	1	102	119	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	9.59e-31	1	102	126	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
1OA3_A	5.22e-21	1	103	118	218	Chain A, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride],1OA3_B Chain B, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride],1OA3_C Chain C, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride],1OA3_D Chain D, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride]
1H8V_A	1.03e-20	1	103	118	218	Chain A, ENDO-BETA-1,4-GLUCANASE [Trichoderma reesei],1H8V_B Chain B, ENDO-BETA-1,4-GLUCANASE [Trichoderma reesei],1H8V_C Chain C, ENDO-BETA-1,4-GLUCANASE [Trichoderma reesei],1H8V_D Chain D, ENDO-BETA-1,4-GLUCANASE [Trichoderma reesei],1H8V_E Chain E, ENDO-BETA-1,4-GLUCANASE [Trichoderma reesei],1H8V_F Chain F, ENDO-BETA-1,4-GLUCANASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XNQ1|XGEA_ASPFC	2.44e-32	1	102	135	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1
sp|Q4WJU8|XGEA_ASPFU	2.44e-32	1	102	135	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|A1D4F1|XGEA_NEOFI	2.73e-31	1	102	135	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xgeA PE=3 SV=1
sp|Q5BG78|XGEA_EMENI	7.87e-31	1	102	136	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	1.64e-30	1	103	138	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PPTG_16277-t26_1-p1.