CAZyme Information: PPTG_16272-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_16272-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	KI669616|CGC3	28807.18	4.7916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669616:386949-387746(+)

Full Sequence      

MQMTSARLAQSVICSNPLSSRQLTMKLSFAALALAAAASSSNAQEFCGRDDFKVVGDYTV
YNNLWGQDNDKAGGQCTTVDGSSGSEIAWHTSFNWAGDNWQVKSYANAALKFDPVQISNV
TSIPTTMEYTYKYDGNIITNVAYDLFTSPSIGGETAYELMVWLAALGGAWPLTTTGQPIK
SVTLGGVEFNLYQGWNNKTKVFTYVAKNMATSFSADLKQFFDELPADNTIETTQYLTHVQ
AGTEPFQGKNATMTVSKYSAAVHTV

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	114	262	6.4e-42	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	4.65e-42	56	262	1	206	Glycosyl hydrolase family 12.
235746	PRK06215	2.97e-11	56	218	50	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22033.1|GH12	8.58e-150	25	264	1	241
AAT66504.1|GH12	2.37e-149	25	264	1	240
EGZ11358.1|GH12	2.37e-149	25	264	1	240
ABB22024.1|GH12	7.87e-120	30	262	7	239
ABG91065.1|GH12	8.74e-120	44	264	23	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	7.29e-71	41	262	22	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VL8_A	7.57e-70	38	262	6	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	2.44e-69	45	262	6	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
6K9D_A	9.62e-49	44	263	1	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	5.57e-48	43	263	1	219	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	5.51e-84	25	262	1	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	1.07e-78	42	263	17	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|Q0CRC9|XGEA_ASPTN	2.73e-74	25	262	1	249	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|G4ZHR2|XEG1_PHYSP	1.66e-73	25	263	1	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|A1XP58|XGEA_ASPNG	6.68e-73	30	262	8	240	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001608	0.998392	CS pos: 43-44. Pr: 0.9374

TMHMM  Annotations     

There is no transmembrane helices in PPTG_16272-t26_1-p1.