CAZyme Information: PPTG_16244-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_16244-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	KI669616|CGC7	50657.42	4.4608

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669616:291536-292918(-)

Full Sequence      

MLRRLAYVATTMATLSVNAAYATTFSTLGGDNGTNTVAQVAPSDDVSQYDQSSSPPTSIN
SNSSTTEQGQIQQNASGSASSQQNSTHIQYSIRNGNVSSVGVNLGGWLVAEHWMTNTADF
WQGVSDDDAGKGEYTAITKAANPDTIRSNLKNHHNTFITESDIADIAAAGLNTVRVPVGY
WIVGFDNDDPSGQAAWTQYSNGTLKYLDALITDWAKKHNVAVLISMHAAKGSQNGADHSS
PSDPGKSHWSAYDENVANTIAMATFLADRYKNEDAFLGIGLLNEPNASTDEDKLYAYYEK
TYAAIRATGNDCVLSVAPLLYKQSPDVMTNFMQAPSYTNVWVEWHPYFVWGYEDTSDYDL
TNTAVKVNFQNSVSQWNARENHNRLFIGEWSFATAGKFSDNQEGYYEFCQAMMDVMYQAG
AGFTFWSWRIYGDESGFNAWSLRSVLRDDRLNAIFFPSAT

Enzyme Prediction     

No EC number prediction in PPTG_16244-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	150	430	2.1e-48	0.9638989169675091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.09e-25	101	428	20	357	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.94e-14	157	428	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29069.1|GH5	1.31e-184	87	460	47	418
UIZ29004.1|GH5	5.86e-160	86	459	35	410
CCA17636.1|GH5	8.09e-118	76	448	115	491
AAM18484.1|GH5	3.33e-105	85	448	6	365
UIZ29723.1|GH5	6.21e-104	92	448	5	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.42e-28	101	429	11	360	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	2.60e-28	101	429	16	365	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	3.31e-28	101	429	11	360	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.60e-28	101	429	17	366	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3N9K_A	6.64e-28	101	429	16	365	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	8.30e-32	101	429	39	385	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	5.56e-31	101	314	31	230	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|O93983|EXG2_WICAO	1.06e-30	101	393	44	320	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12626|EXG_PICAN	7.78e-30	101	429	51	401	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|Q12700|EXG_SCHOC	2.38e-29	101	393	44	322	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999656	CS pos: 22-23. Pr: 0.9733

TMHMM  Annotations     

There is no transmembrane helices in PPTG_16244-t26_1-p1.