CAZyme Information: PPTG_16240-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_16240-t26_1-p1
• CAZy Family: GT30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45233.19	5.7018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669616:280831-282036(+)

Full Sequence      

MLMALCSASTNSSSNTTRLETSTSFTHVRSGIRDGSVRSRGVNLGGWLVAEHWMTADAAF
WQGAEDHFANSGEYTTITKASNPDDIRAKLGDHHATFITEDDIAQIAAAGLNTVRVPLGF
WILGYDNHDPSNQHEWQVYTRGTIAYLDQLIRYWTKKHNVAVLVSLHAAKGSQNGADHSS
PASPGQQFWSQYPENVANTIEVARFLAERYLNDEAFLGIGLLNEPNGNTDEKVLYQYYKD
AYQAVRSTGSDCVLSIMPMLQKQSPDEMVGFMEAPEFTNVWVEWHPYFIWGYEHTPDNQL
VNIAVKQEYKGRVDKWNARAGHNRLFIGEWSVATASNMRRTNPDLFYTFTTEQLKAHEAA
EGGWTLWSWKVSAGNNRDLEDWSLQNLLADDRLGRILRNSS

Enzyme Prediction     

No EC number prediction in PPTG_16240-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	91	372	1.2e-48	0.9638989169675091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.94e-24	40	381	19	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.08e-08	97	369	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	2.69e-231	15	401	24	410
UIZ29069.1|GH5	1.29e-154	21	397	41	413
UIZ29723.1|GH5	1.75e-112	32	390	5	357
AAM18484.1|GH5	4.27e-112	32	390	13	365
CCA17636.1|GH5	7.23e-110	21	388	120	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	5.20e-32	40	387	15	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	6.63e-32	40	387	10	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3N9K_A	7.17e-32	40	387	15	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
2PB1_A	7.28e-32	40	387	16	378	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	7.28e-32	40	387	16	378	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XN12|EXGA_ASPFC	1.17e-38	40	390	43	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q96V64|EXG_BLUGR	5.17e-38	40	387	38	397	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	6.01e-38	40	390	43	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	4.21e-37	40	390	43	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|A2RAR6|EXGA_ASPNC	2.14e-35	40	390	43	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.949738	0.050274

TMHMM  Annotations     

There is no transmembrane helices in PPTG_16240-t26_1-p1.