CAZyme Information: PPTG_15891-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15891-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	KI669609|CGC5	42504.66	8.1843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669609:43006-44115(+)

Full Sequence      

MPPPEVRGSQSHTRAPAWTSTSRFRCVFTTLISLSVVSVLVVSSRIGIPARLKGLQSPHI
LTTTVTERSQSTDYDTAEVKDSSTDNVMIPRLIHQSWKSVYRIPTRFHPWMKSWVEFHPT
WTYVFWTDADNLRLFELLYPQYLHVAKAVRKVSLADMARYALLHQVGGLYVDADFECLQP
FDDLHRENNLFLSSEPLVHSVLLEKSDSAALCNALMASAPRHPFWLSVLDNIKKKFDRER
LKSDAVELTGPRMVKQTYLSPNSTFNLKGSDMVVFTSEYFYPEVAYWNIEPMKTACRQRH
DDAAKEACAWLQRFPKGEFTNKTHATHHWQCTWCRDAQLNEFGALRDIFESPPMRPNITM
TGIEFVVLK

Enzyme Prediction     

No EC number prediction in PPTG_15891-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	109	186	1.5e-16	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.16e-15	87	233	80	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.66e-09	112	184	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.002	112	191	70	150	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI10024.1|GT2|GT32|GT62	3.15e-30	84	336	2	227
QKS49121.1|GT2|GT32|GT62	9.30e-28	89	337	9	240
UDL92565.1|GT32|GT62	1.01e-27	88	333	1	213
AUN93720.1|GT2|GT32|GT62	1.70e-27	88	335	1	225
ANT49605.1|GT32|GT62	1.89e-27	88	360	1	268

PDB Hits     

PPTG_15891-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	5.32e-16	88	234	81	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	4.11e-15	88	233	61	194	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.18e-14	83	234	51	190	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	7.86e-13	89	251	64	219	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q5UQW4|YL373_MIMIV	1.07e-08	88	282	1	185	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999988	0.000030

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15891-t26_1-p1.