CAZyme Information: PPTG_15713-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15713-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		42605.58	8.6381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669611:214898-216100(+)

Full Sequence      

MKFFRPILIAVVALFVQNTEAFTVGSATGLAAGTTGGGSATPVYPTTTAQLVAYLKDSVP
RVIVLNKTFDFRGTEGTTTEAGCRPDYTRECIAKNNGYKSQDVILQSGGMSNTGGCSDGT
SVTVTYDNAAITPMTVTSNKTLRGIGTTGVIMGKGLWLNGDNIIIQNVHITELNRHLVWG
GDAFYIQGSNGGSTAMNKIWLDHVKVSRVGRQFLTTNAASVSTMTISNSDFDGRTDYSAS
CDGRHYWSFIFYGKNTRFSMVNNYIHSTSGRSPKLGGDSSANVIAHIANNYWADNSGHSF
EVGVNSWILAEGNYFKDTTLPLLTGSDGNMYAATATTECNSYLGRSCVANVVSNSGAFGS
RNGATALSKVKSYSAISGYSPRSAVEWSKTTKNFGIGVLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	317	3e-82	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.79e-29	122	315	2	186	Amb_all domain.
226384	PelB	1.48e-09	97	322	51	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74068.1|PL1_4	1.80e-286	1	400	1	400
ADN18834.1|PL1_4	1.92e-281	1	400	1	400
ADN18833.1|PL1_4	1.56e-218	1	400	1	400
ACR19248.1|PL1_4	5.42e-201	42	400	133	491
AHX74069.1|PL1_4	3.36e-173	4	400	4	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	9.04e-87	24	397	4	358	Pectin Lyase B [Aspergillus niger]
1IDK_A	7.20e-83	25	358	5	321	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.27e-80	25	358	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	8.28e-91	1	356	1	339	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	9.48e-91	1	358	1	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B0YCL3|PELB_ASPFC	2.37e-90	25	384	24	369	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|A1CFS2|PELA_ASPCL	7.33e-90	15	358	12	340	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1
sp|Q2TXM4|PELA_ASPOR	4.26e-89	25	358	24	341	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999754	CS pos: 21-22. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15713-t26_1-p1.