CAZyme Information: PPTG_15712-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15712-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	KI669611|CGC1	39767.72	9.7414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669611:212514-213703(-)

Full Sequence      

MKFLQPILIAVVTFAVTSVDAFTVGSATGFAAGTTGGGNAAPVYPTTNSQLAAYLKDAVP
RVIVLSKTFDFRGTEGTTTTNGCRPDYTRACIAKKNGYKSQDVILSSGGMAGTGGCSGGT
SVKITYDNAAQNRLVVTDNKTIRGIGTSGVIMGKGLWLNGNNIIVQNIHITELNRHLVWG
GDAIYMQGSNGKAMSKIWLDHIKISRIGRQFIVANNAGVSSLTISNSDFDGRTDYSASCD
GRHYWTFLLYGKDTKVSMVNNYVHSTSGRSPKVGGSSDSNAIVHVANNYWADNSGHSFEL
GQNGFVLAEGNYYQDTVAPLSAGNEGAIYAATASTECKNYLGRSAVQGNSAVSKFTPRAA
KKLVKTTKNFGIGVLN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	315	1.8e-81	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	5.94e-33	122	316	2	189	Amb_all domain.
366158	Pec_lyase_C	2.74e-09	127	313	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	6.66e-09	139	322	102	282	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18833.1|PL1_4	3.23e-237	1	376	1	400
ACR19248.1|PL1_4	1.63e-217	42	376	133	491
AHX74068.1|PL1_4	1.01e-203	1	376	1	400
ADN18834.1|PL1_4	2.35e-202	1	376	1	400
ACR19258.1|PL1_4	1.70e-155	20	332	20	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.19e-80	25	346	5	311	Pectin Lyase A [Aspergillus niger]
1QCX_A	3.35e-80	24	344	4	310	Pectin Lyase B [Aspergillus niger]
1IDJ_A	4.21e-78	25	346	5	311	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	1.65e-89	1	346	1	331	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.30e-87	25	356	26	343	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.30e-87	25	356	26	343	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|B0YCL3|PELB_ASPFC	4.36e-87	25	353	24	337	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|Q5BA61|PELB_EMENI	1.96e-86	1	344	1	329	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999786	CS pos: 21-22. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15712-t26_1-p1.