CAZyme Information: PPTG_15707-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15707-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		53191.49	7.1707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669611:198348-199850(-)

Full Sequence      

MARFQFALAAMLALAANSANAFTVGSPSGIAAGTTGGAGGKTVYPTSNSELVNYLASNDP
LVIVLNKTFDFRGTEGTTTETGCRPDYTRECMAKKNGYKSQDVIISGGSMANTGGCTGGT
EVKITYDNAARKRMTVTGNKTIRGIGKSGVIKGKGLMLDGDNIILQNIHITELNPHVVWG
GDAIFMQGKQATTPLNKIWLDHIKVSRVGRQMVVTNKAGVASMTISNSDFDGNTEYSATC
DGHHYWTFLFYGKNTGVSMLNNYVHGTSGRSPKIGGNPNERVVVHVANNYWGNNTGHSFE
LGANGYVLAEGNYFDNTKQPLFAGSDGSLYAATNSDECSKYLGRSCAANTLVDSGTFASR
NGGNALKTIKGVSTVVNYKPDITETTTGSQQQQQSSKSDGSQQEQPSQSSGSQQKQSSQT
SDDSEQQASQTGGSAQEESFVTSGSEQQQVQQEQQWGGSLPYHGGSEPNFGSQSRKLAET
KNLENEWKQTTGNFGVGKLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	316	7.4e-83	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.67e-32	122	318	2	190	Amb_all domain.
226384	PelB	1.45e-13	97	321	51	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.01e-06	118	314	14	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	1.03e-195	1	500	1	441
ADN18835.1|PL1_4	4.17e-195	1	500	1	441
ACR19258.1|PL1_4	1.21e-184	1	333	1	333
AHX74068.1|PL1_4	2.92e-180	4	380	4	381
ADN18834.1|PL1_4	1.68e-179	4	380	4	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.89e-78	24	358	4	323	Pectin Lyase B [Aspergillus niger]
1IDK_A	5.80e-77	25	358	5	322	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.84e-74	25	358	5	322	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	9.43e-90	24	363	24	347	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	9.26e-88	3	357	2	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|A2R6A1|PELF_ASPNC	4.00e-87	10	378	12	373	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	4.00e-87	10	378	12	373	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|Q2TXM4|PELA_ASPOR	2.88e-86	25	358	24	342	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999785	CS pos: 21-22. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15707-t26_1-p1.