CAZyme Information: PPTG_15699-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15699-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		49756.61	6.6534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669611:114917-116302(-)

Full Sequence      

MGCLRLAIAAALALAVKSASAFTIGTAPGLAAGTTGGANGTVVYPKTNEELIDYLNASEP
LVVVLNKTFDFRGTEGKTTEIGCRPQSARECIAANNGFKSQDVILKNGMNNTGGCENGTE
TTVTYDNAYRWRMNVTSHKTIRGIGKLGVIMGKGITLRGDNIIVQNIHITELNRHLVWGG
DALYMEGMVNGTKTMNNIWIDHVKVSRVGRQMLVTNKAGVATMTVSNSDFDGETDYSATC
NGRHYWTILLYGKKTGVSLLNNYVHSTSGRSPKIGDKNSSVIAHVANNYWDNLSNHSFEL
DGNAWMLAEGNYFNSVENPLYKKGEGFLYAATGVDECTKVLGRACEENTLVSSGNFTSRD
GTAALEAMKPYSAITKYSPGSDDTNSKQQSTDDSVHQSEEGASSGESVHQSNQLSLTMPM
VKQYTPGSVKTSPLEQQWTQASDIEKVWAQTTRNFGVGGLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	122	314	4.6e-76	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	5.32e-29	122	313	3	186	Amb_all domain.
226384	PelB	1.48e-15	29	320	43	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.67e-04	118	313	15	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	8.34e-185	7	461	7	441
ADN18835.1|PL1_4	3.38e-184	7	461	7	441
AHX74068.1|PL1_4	2.25e-167	10	381	10	383
ADN18834.1|PL1_4	2.25e-167	10	381	10	383
ADN18833.1|PL1_4	2.84e-153	22	379	22	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.04e-73	25	365	5	329	Pectin Lyase A [Aspergillus niger]
1QCX_A	1.24e-71	24	380	4	345	Pectin Lyase B [Aspergillus niger]
1IDJ_A	5.33e-70	25	365	5	329	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N316|PELF_ASPFN	2.65e-83	24	360	24	347	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	2.65e-83	24	360	24	347	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q8NJK6|PELF_ASPNG	7.19e-83	29	362	30	350	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	7.19e-83	29	362	30	350	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.59e-82	24	358	24	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999777	CS pos: 21-22. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15699-t26_1-p1.