CAZyme Information: PPTG_15563-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15563-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		40745.18	4.0809

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669610:106325-107479(-)

Full Sequence      

MVNVLRTTSALAMVATSFGFADAGNFKCTGINYNIRAGPDWAPANEKCKPASLIATELAL
LKGVTDTIRLYSLTDCDQATVVVPAAIEAGLKVELGMWVDSSASSFEAEKAAFKTLLESG
VVQSEHIVGIHVGSEAVYREDVTVDVAISYLEEIRTLCKANAGAAGIPLTIADIGDTYSA
YPKLIEAVDYVSANYFPFWEKTDIDVAAKSFYKRFSALVQTASTYNKEVVIGETGWASDG
VGAGASPATAANAAKYFYDFYTLATEKNLMYYYFSGFDEAWKLPTLEANETVEAYFGLFT
KDGVLKDSISAMFDNNTGSFNGSDSATITLVGGDASTTTAGGDDATSGDATQNDTTSDGV
EDDSTSITQTSTTTTSTSHKDCTM

Enzyme Prediction     

No EC number prediction in PPTG_15563-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	44	306	2e-24	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.78e-43	30	302	47	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.65e-11	30	309	2	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM18482.1|GH17	6.46e-207	1	337	1	338
CAJ90910.1|GH17	1.18e-181	1	327	1	327
UIZ28880.1|GH17	6.22e-165	13	332	1	320
AIG56195.1|GH17	1.13e-77	10	306	3	304
AIG56146.1|GH17	3.36e-74	21	331	15	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.52e-30	30	310	39	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.08e-29	30	310	39	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	4.02e-08	183	306	230	380	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43070|BGL2_CANAX	6.64e-28	48	314	35	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	3.36e-27	48	314	35	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P15703|BGL2_YEAST	9.74e-27	5	313	1	312	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	1.49e-21	44	306	51	313	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	3.15e-21	7	302	5	292	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000578	0.999406	CS pos: 23-24. Pr: 0.8721

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15563-t26_1-p1.