CAZyme Information: PPTG_15179-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15179-t26_1-p1
• CAZy Family: GT19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		37397.24	10.0438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669608:140672-141757(-)

Full Sequence      

MKNLSTALTVLALFSATINGSPMLRQEAEASSCTLSGTYKSGTDISSCSTLTIGTLTVPA
GVTLDLSKAKTGANIKISGTVTFGEKKWAGPLVLLGGTNLKVSGSGTLDGQGAWYWKQGT
SISRPVFFRLHGVTGSTLSGFKIKNSPYRTFSILNSEKTTISGLTLDSSAGDGTAKNTDG
FDLSKNDYVTITGNKIYNQDDCLAMQSSTNTVFSNNYCSGGHGISIGSLGGSSVSSADTV
KGLTVKGNTIVNSVNGIRIKTIVDLKGLVSDVTYTNNKLSNVKNAIVIHSDYSKSKGGYT
GKATSAVTIKDVTISGLSGTATNLYNIVANSKVVSNWKFSGVTVKASKTGTCNGQPSTVK
C

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	45	361	4.5e-69	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.77e-68	48	361	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
227721	Pgu1	1.85e-21	45	288	106	404	Polygalacturonase [Carbohydrate transport and metabolism].
215426	PLN02793	4.79e-20	47	321	79	368	Probable polygalacturonase
215540	PLN03010	1.27e-18	53	361	80	386	polygalacturonase
177865	PLN02218	5.51e-18	47	330	94	391	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABV82741.1|GH28|3.2.1.15	1.81e-248	1	361	1	361
UKP15059.1|GH28	9.99e-230	1	361	1	361
UKP15061.1|GH28	2.01e-229	1	361	1	361
ADN18855.1|GH28	3.71e-225	1	361	1	361
ABU46393.1|GH28	2.31e-212	1	361	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	7.32e-71	32	361	10	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	7.32e-71	32	361	10	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	1.82e-69	32	361	2	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1IA5_A	2.21e-68	30	361	1	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1NHC_A	7.02e-66	31	361	1	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CMU3|PGLR1_ASPTN	3.38e-71	30	361	32	368	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1
sp|B8N8M2|PGLR1_ASPFN	5.16e-70	31	361	32	367	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1
sp|Q2UHL4|PGLR1_ASPOR	5.16e-70	31	361	32	367	Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgaI PE=1 SV=1
sp|P41750|PGLRB_ASPFA	5.16e-70	31	361	32	367	Endopolygalacturonase B OS=Aspergillus flavus (strain ATCC MYA-384 / AF70) OX=1392242 GN=pgaB PE=2 SV=2
sp|P26215|PGLR_COCCA	6.68e-70	33	361	30	364	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999745	CS pos: 25-26. Pr: 0.6821

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15179-t26_1-p1.