CAZyme Information: PPTG_15164-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15164-t26_1-p1
• CAZy Family: GT105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	KI669608|CGC2	46757.20	8.2332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669608:78307-79665(-)

Full Sequence      

MKLLSAAFAAFALLAATTDGSTMLRQEAESKHHKHHQVQNSATSSGSNNQQQQQQQQQQQ
QQQQQQQQQQQQSTNSGSNNAQQQTQTSTTSSGSSTQQQQQSSYASSAGGAGSPTGTVTA
SSGCTLTGTYKSGTDISSCAAVIIDSLTVPAGVTLDLTKTKSGATIEFTGTTTFGTKTWE
GPLVLLSGSDLTVKGSGTLDGQGAWYWKQGTSISRPVFFRLHAVTGSTLSGFTLKNSPFR
TFSILNSEKTTISGLMLDSSAGDGTAKNTDGFDLSRNDGVTITGNKIYNQDDCLAMQSST
NTVFSNNYCSGGHGISIGSLGGDSVTSSDTVSGLTVTGNSIINSVNGIRIKTIIGLKGLV
SNVKYTNNKLSNVKNAIVIHSDYSKSKGGYTGSATSEVAIQGVTISGLSGTATNLYDVVA
NANVVSDWTFSGVTVSASSKGSCSGQPSSITC

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	137	452	1.2e-65	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.32e-66	139	452	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.15e-25	189	426	139	362	polygalacturonase
215426	PLN02793	4.96e-25	138	412	79	368	Probable polygalacturonase
177865	PLN02218	6.94e-22	195	412	164	382	polygalacturonase ADPG
227721	Pgu1	4.23e-21	190	379	200	404	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKP15064.1|GH28	6.70e-199	111	452	131	472
UKP15065.1|GH28	6.70e-199	111	452	131	472
ADN18844.1|GH28	7.21e-199	122	452	37	367
UKP15066.1|GH28	2.71e-198	111	452	131	472
UKP15067.1|GH28	7.24e-198	111	452	139	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	3.26e-64	124	452	11	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.26e-64	124	452	11	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	4.32e-63	124	448	3	333	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]
7E56_A	7.84e-63	124	452	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	5.41e-59	124	452	3	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26215|PGLR_COCCA	2.28e-66	111	452	18	364	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|Q0CMU3|PGLR1_ASPTN	1.97e-65	121	452	32	368	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1
sp|Q12708|PGLR1_SCLSC	7.62e-65	137	452	62	380	Endo-polygalacturonase OS=Sclerotinia sclerotiorum OX=5180 GN=PG1 PE=3 SV=1
sp|Q9P4W3|PGLRB_ASPNG	7.08e-64	124	452	28	360	Endopolygalacturonase B OS=Aspergillus niger OX=5061 GN=pgaB PE=1 SV=1
sp|A2QCV8|PGLRB_ASPNC	7.08e-64	124	452	28	360	Probable endopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000956	0.999013	CS pos: 20-21. Pr: 0.7409

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15164-t26_1-p1.