CAZyme Information: PPTG_15162-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_15162-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		41766.65	5.6854

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669608:74218-75444(-)

Full Sequence      

MKLFKSTLAILALVAAMVNGDDVDQSEVVQQSQENQDYEVGQVSPASQVGQDSPYQVDQD
DTCTLTGNYTEGTDVSQCSTIVIDSLSVPAGVMLDLTNVTDGANIKFQGTSTFGPKLWAG
PLIKLTGNDLTVTGPGTLDGQGAWYWPQGQNITRPVFFRLSRVANSKLSGFTIKNMPFRT
FSILSSNYTTISELTIDSRAGNGSAKNTDGFDLSRNNHVTITNNRVYNQDDCLAMQSSSN
TVFSNNYCSGSHGISIGSLGGPEQNVNTTVSGLLVKDNTIVNSTNGIRIKTIIGLKGLVT
NVTYTNNRLVNVKHAIVMHSDYNKTKGGYSGIPSSLVNITNIKIDGLFGSATNLYDIVAN
PAVVSNWEFKNVAVNATNIGKCQGGPSNVQC

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	75	390	7.7e-64	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	5.67e-76	78	391	1	312	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.19e-28	116	391	122	386	polygalacturonase
227721	Pgu1	1.68e-24	128	313	199	399	Polygalacturonase [Carbohydrate transport and metabolism].
215120	PLN02188	4.81e-24	128	354	122	351	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	3.18e-22	78	342	80	359	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW22993.1|GH28|3.2.1.15	3.72e-279	1	391	1	391
AAK98644.1|GH28	2.98e-242	1	362	1	362
ABV82743.1|GH28|3.2.1.15	2.26e-204	1	391	1	391
ADN18843.1|GH28	1.46e-202	1	391	1	390
ABD59284.1|GH28	2.63e-171	63	391	38	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	7.46e-73	53	391	1	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	7.46e-73	53	391	1	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	1.31e-71	63	391	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1IA5_A	7.97e-71	62	391	3	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1NHC_A	6.12e-66	62	391	2	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CMU3|PGLR1_ASPTN	3.87e-72	63	391	35	368	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1
sp|Q2UHL4|PGLR1_ASPOR	8.29e-71	57	391	28	367	Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgaI PE=1 SV=1
sp|B8N8M2|PGLR1_ASPFN	8.29e-71	57	391	28	367	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1
sp|P41750|PGLRB_ASPFA	8.29e-71	57	391	28	367	Endopolygalacturonase B OS=Aspergillus flavus (strain ATCC MYA-384 / AF70) OX=1392242 GN=pgaB PE=2 SV=2
sp|P47180|PGLR_YEAST	7.74e-70	61	387	25	355	Polygalacturonase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGU1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999789	CS pos: 20-21. Pr: 0.9813

TMHMM  Annotations     

There is no transmembrane helices in PPTG_15162-t26_1-p1.