CAZyme Information: PPTG_14801-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_14801-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		92852.30	5.2666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669601:392096-394651(-)

Full Sequence      

MNVDLVLGLLCWVCNSASWLALAATASPAAHERVYDPNTTVFADLRSSVEPSITSSGVDI
DALLANMTIHQKAAQMTQMDIYSMMDGDERDPKKALKRDVVARYARMGVGSILNSPFAGG
PVGGRTGWSASEWREVIHQIHHIYKEEGAAVPMLYGVDTIHGATYVQGATLFGQPISAAA
SFNPELVYKMGAVAAKDTLSAGIPWIFSPVLGIAVQPKWSRVYESFGEDPLVSSVMGAAL
IEGLQSSGKVAACMKHFIGYSNVREGLDRADNVITDWELVNYYAPSFLAAVRAGVRTAME
SYVSVNGVPVIASKKLLVDLLRHDMNFSGLLVSDYSEVDRMYSEHHLVPSVAEAVRVTLQ
ETSLDMNMSPDLQAFGDTIESLFEKGLIPESRLDESVRRILETKRDLGLLEPDYYDNFER
DWMSTASTVGNTADQADALKLAQESAILLENHNSALPIDLTEANNIFVTGPVSDNKGFQC
GGWSVFWQGSSDSTIFPNGLTFKEAIQAKAASAGGHMKVDHLEVVGIDGNVNPHDFQRGL
QLAAKSEYTLVVLGEPNYAEKTGDLLGSMALPAGQLRYLEELTKLNSTKVVLVLISGRPR
LLEGAHNHADAVILSMLPCEQGGQALVDVIFGDVNPSARLPITYPARSTQLLPYFHRVNT
RCQPFDECPVLWQFGHGLSYTRFEYSTLRLNSTHVHATRGALKAAVTVTNRGTRPGKEVV
LVFVSQKFRRASVPETKLLKAFKKLDELAPGASQDVEFVLTPEDWSYYEPHVVGRGFQRW
AEPGEFVVSVLPSSTDASTMAVPRVLDNVSERNSQIKNRAGPGFMTSNGSEWPSAAPEYA
SELSASFYVVL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	147	357	4.3e-60	0.9259259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.29e-94	60	790	38	750	beta-glucosidase BglX.
224389	BglX	1.42e-69	67	486	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.41e-56	68	402	1	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.29e-49	166	762	108	744	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	3.09e-38	446	680	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	4.99e-206	52	794	20	744
UIZ27116.1|GH3	7.95e-203	76	794	1	703
UIZ29432.1|GH3	1.85e-186	62	805	31	753
UIZ29613.1|GH3	1.64e-184	62	805	76	809
CCA27737.1|GH3	1.25e-179	60	801	68	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	8.84e-103	47	788	4	737	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	4.82e-80	60	799	14	746	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.43e-79	60	799	14	746	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	1.92e-78	60	790	7	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5Z9S_A	4.52e-78	56	794	24	775	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.03e-130	60	790	80	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.32e-102	40	788	19	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.58e-74	60	790	38	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.49e-73	63	790	41	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.25e-72	147	794	61	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.082771	0.917184	CS pos: 23-24. Pr: 0.8755

TMHMM  Annotations     

There is no transmembrane helices in PPTG_14801-t26_1-p1.