CAZyme Information: PPTG_14482-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_14482-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786		85557.03	4.2238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669603:259928-262288(+)

Full Sequence      

MLTSWAVALGCIAAFTTVPVAARNLADDVYDSQAQAIVDGFSIAEVLGQMTQITITQVLN
SDYSLNEDSVRTYAKLYVGSYLNTPWGSEIDGKWGWNATEWRAIVTRIQAITMEENGGHP
MVYGLDSVHGANYVAGSVLFGQEINSGASFNPDLVYEVGRITGRDTEAAGIPWVFGPILD
LAQNPLWARTYETFGEDPYLCSVMGDAIIRGLQSNNQTAACMKHFVGYSKTPTGHDRDGV
TMADFDLLNYFVQPYQAGISAGALSTMENYISINGIPVVANTKILEDLVRNDLNYDGVVV
TDWAEINNLKDWHRVVDTYEEAVRLSLTRTALDMSMVPYDTEFITHATTMLSSFPEYESR
LRESAKRVIKMKLKLGLYETPVPGASNEFLVGNDDDKAVALDLARESIVLLKNNDNILPL
SNGSSVFLTGHSADNVGYQCGGWSIAWQGYSGNDMYPNGISVRQGLENVVGNNSFTYFNG
LNADGTYSDADLATAVNLASQHEYTIAVIGEDTYAEKPGDIDDLDLPAGQIAYVEALAAT
GTKVILVLFEGRPRLLGSLPDMASAVIHGLLACELGGQALTEIVYGQVNPSGRLPLTYPK
DSGNVMIPYNHRVTTKCVDDTGSYVDCEMQWDFGTGLSYTTFTYSALTLSKTTVSGPDDA
LTASVFVTNSGSVAGKETVMLFVVQPYRLISVPEVKMLRKFKKISLEPGITEEVTFTLTA
DDWSVYDPQIGSGFNQVAEDGTFVVAIKPETDCDVYNTITNELCAQFTLDTGSVNFGING
TTSRRR

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	323	7.2e-60	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.40e-111	120	747	105	750	beta-glucosidase BglX.
224389	BglX	1.58e-63	95	445	37	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.97e-47	42	369	1	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.65e-46	130	718	100	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	5.89e-42	408	639	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	770	1	763
UIZ29613.1|GH3	0.0	26	770	66	820
UIZ29432.1|GH3	0.0	26	770	21	764
UIZ27116.1|GH3	5.77e-311	50	769	1	724
CCA27737.1|GH3	5.54e-293	32	769	66	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.99e-135	27	722	10	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	8.40e-81	105	747	53	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	4.31e-80	105	747	53	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	4.39e-80	105	747	54	719	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	8.02e-80	105	747	85	750	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.86e-143	31	747	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	3.00e-134	27	722	32	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	9.56e-86	104	760	50	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.12e-79	120	747	105	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	1.10e-78	120	751	105	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000507	0.999480	CS pos: 22-23. Pr: 0.9607

TMHMM  Annotations     

There is no transmembrane helices in PPTG_14482-t26_1-p1.