CAZyme Information: PPTG_14134-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_14134-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
980		108408.19	5.5296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669600:372980-376448(+)

Full Sequence      

MTLGYKLCLMFFVLVARAACALIDGDDPVTNLTVWYPRHGGATTLPLAHKFIIGANSSDG
FKSRYGNMLICVELNGVAKKCSSTIGMRIRWQNLPYGSYVARAYFSDGENGARFHETGPV
SFQILGAEDFDAHIKQQLEQIRADQNFPPDLSISQWMQRIQSEDLPFQNTLVNRPTIVQG
SPSDELRLVIGIKTAVLKYFAQRQAIRETWANTTGLPTHVNVSFLDQILEAVELERDIYG
DLLTDELECDDEYSLLAGKVSAFLEWVIAELPRTEFVMITDDDDFVRVDKLVEDLEVLPR
EGFYIGDLPDTLHSAPIWPIRDPANAYYISRDNYPLEQLFPYAGGPHYLLSMDCVRFIGK
NRERLASIGGDDTSVALWLLAVQIHVQYTSAFASLRLWPCMDRLQIYHLWIDDTPRQLKR
LKRTMQVKYPIMGLSYARSLFAICGGGGSLKSGIKNTVDIYQLSDTDPTGFTKEITADTG
LELASGVAFSHDGQLIAVSVSAGCWVYALDLKEKTITLLVKFRTDFHEEDSSQTCARFVG
NSTILTGGEDGVVRIWRLSRDPSKPEKAVGSAKALTVPEERDLHANVVAEEQPKLGDCVI
NGANMVTLTREYRGHTKRIRDIDVDLSHRNLVASSSEDQSCHLWRLTEVTPICKFSKDDA
LDIALQRLPTKPIVGPRKHVFRCVRFSNSGRRLYTMLTPARGDSILIKWKPGTIAQENEE
QWTWVVEETAIAGEKPVASLCVSQDDRFVCAAAVTGDIKVFLASTLQQYTIKSTEQHSFA
ITGMSFAPSADKQSSIFHLVSGGADKSLLRHEIPLEGGIVKSGMEIVTGGLKNVVSATVG
LGLNLWMATTLLFILLLFIHAKTAMLLDGPSAGFNDLASFSFDSSDGLVTIGALVASSVV
TWLFALHSSVTSRFFWNGLLCLLSGLVAFSVAISADLEVNWHTGDAAIDELLEYKIAILL
GVCCVAFFFCHSLLVLALSN

Enzyme Prediction     

EC	2.4.1.122:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	202	385	1.3e-30	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	3.26e-22	201	387	1	193	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	1.04e-11	178	379	377	579	beta-1,3-galactosyltransferase; Provisional
238121	WD40	1.86e-10	469	808	6	243	WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.
225201	WD40	3.08e-08	503	925	39	430	WD40 repeat [General function prediction only].
238121	WD40	1.79e-07	456	695	73	278	WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHO04084.1|GT31	2.45e-17	182	418	431	665
QHO60282.1|GT31	2.45e-17	182	418	431	665
AWP13074.1|GT31	2.47e-17	188	428	82	323
QCD76954.1|GT31	3.25e-17	182	418	437	671
SVE71833.1|GT31	3.88e-17	163	394	50	277

PDB Hits     

PPTG_14134-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O54904|B3GT1_MOUSE	4.88e-16	188	428	80	321	Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
sp|Q9Y5Z6|B3GT1_HUMAN	4.88e-16	188	428	80	321	Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
sp|Q9MYM7|B3GT1_PONPY	4.88e-16	188	428	80	321	Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1
sp|Q7JK26|B3GT1_PANTR	4.88e-16	188	428	80	321	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1
sp|Q7JK25|B3GT1_PANPA	4.88e-16	188	428	80	321	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999725	CS pos: 20-21. Pr: 0.9527

TMHMM  Annotations     

Start	End
837	859
914	936
956	978