CAZyme Information: PPTG_14132-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_14132-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
927		104780.97	5.5994

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669600:368274-371057(-)

Full Sequence      

MRRYHVAFLTIWSLYVGCIAAASPPSTLEVGHPFHHAKLAPSSGIVENQEEDPISKFRVV
FPVDGDVETLPLAFRVDIEVQSVSRYRAEYGDKLLCVELNATWQECGSFAEASIGFDGLP
TGSYFARAFITDERGIVRYRETPSLTITVVTDEDFNVYSSAMMELNGDSSRNGESLLNWA
TYQQILARLSIPTIGVTKSSVNTNKTQLVIGVKTAVVENFEYRQSIRETWASPNALPHDV
KVVFVGCTPNLADIQNKDKRERIQAAISLEKQTYADLLTDELDCEESSEDLPKVKGFLRF
VTNAFSQAPFVMIANDDIYLRADRLEHELRREDHLQRLYIGQVWKTLHDRTLEDYYPLHT
YPSFAIGQHYLLSMDCARFIAKNSGRLHGLGGADDISVALWLLTMQVHVENTVAFSGLRT
GTCQNKLISLADVSSFGIRFIHANLVDKRALCDGFDEVAWQRNKTNAEIDSPSHSSFASL
VEIQAYVHDLEDTEYLLITTVVSTRGTAGVKVSYHPSAETFRAYSRRVCLEARILIHNTN
PKSWMCHGIAQTLRTRIQELFHRVEAIGSIGPGFLELWRHNLFVANEDASPLIVGYTTES
SYASVVFECIFKAIFESHTRPILVVPEKVLRLYYGNNPDVFIFSIFDADCEPMTNDGCHE
MIAYYMQEYLYPVEKDRASKVMMISGEAIDTKELDDRVPLLSSVSIVPRLQHVYLPVVSI
SFAERLRNNPTELLSSASRPLIDPSERRFCAYLYARCDRPHREYMFDLLNAVEPVDALGI
CAGSSRPPDKSYKASRYAKWFNDEAVTSYKNYKFVVAFENSAEPGYVTEKLVNPLLAGSI
PIYLGNSTTASQLFNPDSYIDCGHFEKLEDCAAFVLEVHKSPRLYDQMRREPPIRNITLF
DEVFSWHPSVPSRAMADKVARMLQLDI

Enzyme Prediction     

No EC number prediction in PPTG_14132-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	731	890	4.4e-34	0.42939481268011526
GT31	223	411	2.3e-29	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	4.34e-15	761	885	17	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
250845	Galactosyl_T	3.15e-13	223	411	3	194	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPW18992.1|GT10	1.03e-19	626	892	23	267
QQR32886.1|GT10	5.10e-19	745	892	124	265
ANU61948.1|GT10	5.10e-19	745	892	124	265
ASB35439.1|GT10	5.10e-19	745	892	124	265
AEJ34901.1|GT10	6.41e-19	713	892	43	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	2.07e-13	743	897	176	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.57e-12	743	897	176	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	4.26e-18	713	892	398	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|O30511|FUCT_HELPX	1.91e-12	743	897	176	316	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
sp|Q9C8W3|FUT13_ARATH	1.25e-10	755	887	222	359	Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
sp|Q6NTZ6|FUT10_XENLA	2.84e-10	587	887	68	339	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2
sp|Q9VLC1|FUCTB_DROME	8.04e-10	752	896	175	324	Alpha-(1,3)-fucosyltransferase B OS=Drosophila melanogaster OX=7227 GN=FucTB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005533	0.994444	CS pos: 21-22. Pr: 0.8412

TMHMM  Annotations     

There is no transmembrane helices in PPTG_14132-t26_1-p1.