CAZyme Information: PPTG_13879-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_13879-t26_1-p1
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		33753.74	7.0037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669597:347568-348733(+)

Full Sequence      

MKTLLLLLLACTLTPSAVFGHGYIVNPEMTWVVNPFYDKNAPAAFYDASSTFGQNPLDIY
PNLRHIVAQDTPYTNIPLIAANANKNCGMTSTTGPTRTISGYLKFDVDPSALHEGPCEVW
VDDVRTMVARSCKTTYTGRPWNIPVDMTKCTGSTCVVQFIWIGTHNPTYEVFKNCFPVAS
GTTTSQAPSTQAPTTQAPATQAPTTSPTSCTNVAQNGGTCGASNGNKYCPGTQCCSQYGY
CGVGTAWCSSNPNSIYNGNGKCSGGGTVACSPVAPYGGSCGASNGGVYCPGSQCCSQYGY
CGVGSPWCDNNPNSIYNGGNCA

Enzyme Prediction     

No EC number prediction in PPTG_13879-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	12	211	5.7e-41	0.8163265306122449

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395135	Chitin_bind_1	1.07e-06	219	250	1	32	Chitin recognition protein.
395135	Chitin_bind_1	1.33e-06	279	310	1	32	Chitin recognition protein.
211311	ChtBD1	1.30e-05	220	251	2	33	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211311	ChtBD1	4.19e-05	279	311	1	33	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
214593	ChtBD1	2.56e-04	280	314	2	36	Chitin binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETN06075.1|AA17|CBM18	3.33e-238	1	322	1	322
ETK82650.1|AA17|CBM18	5.52e-237	1	322	1	322
ETP12314.1|AA17	2.45e-145	1	217	1	217
ETI42600.1|AA17	8.10e-144	1	217	1	217
ETO71194.1|AA17	4.21e-136	1	187	1	187

PDB Hits     

PPTG_13879-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_13879-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999733	CS pos: 20-21. Pr: 0.9778

TMHMM  Annotations     

There is no transmembrane helices in PPTG_13879-t26_1-p1.