CAZyme Information: PPTG_13811-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_13811-t26_1-p1
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	KI669597|CGC2	86419.47	4.4906

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669597:82282-84639(-)

Full Sequence      

MLKSWFIPAVYAALCRGAHSTVLADKWDERADAIMATFTEADIIGQMTQLHINMVLTDDL
QVDEDKVREYGKLRVGSYMSSPFTAGPRNGTYTWTVDEWRERITKIQDISMEENGGHPIV
YGVDSVHGANWVEGAVLFGQQINGGASFNPDLVYEMGRVTGRDSEAAGMPWVFGPILGIS
RNPLWARTFETFGEDPYLNSVLGDAIIRGLQSNNHTAACMKHWIAYTKTPSGHDKDAAQV
TDYDLLNYFLPPFKAAAEAGAISAMENYISVNGIPTIANGKLMNALLRDDLGYDGMMVSD
YAEIEQQTDFHRTARTYAEAVRLSLTRTSLDMSMVPDDISFVNDTKALLAQSPQYLQRLK
TSARRVVKMKLKMGLYDTPMPGEQNLALVGNDDDVAAALELARESIVLLQNNDSTLPLPE
GAQIFLTGFAADSIGRQCGGWTTTWQGYTDQDGHLPHGITVKSGIEQIVGDYRVNYFNGL
NQNGSYSESDISVAKEMASKVEYTIAVIGEDPYAEKPGDIENLALPAGQVEYIKELASTG
TKVIVVLFEGRPRLLGEIPQNVHAVVNGLLPCELGGQAMAEILYGKVNPSGRMPITYPKR
PANVEMTYNRPVSSMCQDSLEGGAFYCENQWDFGTGLSYTNFTYSAVRLSRNVVQSSSES
VDVSVDVTNSGSMAGKETVMLFLIQPYRSLNVPEMKQLKKFSKISLEPGQTQTVNFALTA
DDWSVYYPQMGHGLKRVAEDCDYVVAIKPETDCDVYNETAVVNPLCATFTLSTGDYPFGS
LEEPW

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	321	1.2e-57	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.81e-94	1	747	9	750	beta-glucosidase BglX.
224389	BglX	1.96e-61	115	464	58	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.11e-44	79	716	69	740	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.65e-43	406	639	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.39e-41	44	366	6	313	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	7.63e-314	1	771	1	762
UIZ27116.1|GH3	3.56e-282	47	771	1	724
UIZ29613.1|GH3	3.78e-279	1	777	46	825
UIZ29432.1|GH3	1.26e-278	1	777	1	769
CCA27737.1|GH3	2.75e-275	30	771	67	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.13e-129	44	722	30	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	1.34e-78	28	747	11	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	6.81e-78	28	747	11	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	1.96e-75	33	732	9	707	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5M6G_A	8.73e-75	29	597	49	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	4.69e-131	28	724	77	792	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	8.46e-129	44	722	52	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.12e-80	118	730	105	737	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.11e-79	100	730	86	737	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.22e-76	95	754	45	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.581867	0.418132

TMHMM  Annotations     

There is no transmembrane helices in PPTG_13811-t26_1-p1.