CAZyme Information: PPTG_13490-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_13490-t26_1-p1
• CAZy Family: GH72|GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	KI669593|CGC1	89162.17	7.9405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669593:155288-157621(-)

Full Sequence      

MDERPMLRGIFAFEDEETPEWRRVVMSETSGGVPKFATKAECEDFIRKHCWRGSNPDFPK
LQHVFSMLVDWQQIKEILIPKIEEYDQKFPLEPAPQISADNRFVQGEGLPIANDVDYRVN
MPFHQQTNRESTHNTLHYLFFHMRCGIFVMIRRRRVVIFAPFANKDYENNWGQNVTFDSS
DGSMFAYYREKQRYYRRENIIPDVKKWWANGNIICNEHCRYRNKEDETQYWGDQFLTQLR
DMLEDACKHRNIPDCEFFINKRDYPHLKENLSEPYGFLFDKNDRNPDEDIPLTEHRYSTY
APIMSFYVSKRFADIPFPCSEDWEAATGLVFPQSFRHTHCDQCPCRNSVHCENDWECFCD
VGANGRKRHGIEGARDLFTANNFRKFYKPWEDKVNTAFFRGSATGGGTTIETNQRLHLAH
LSNTWKKDSTMNGKTESDAAGGDQELVPLLNAEVTTWNLRDKKIAGKPMTFLRHEEFIFE
GGRQHFIPIYEQSKFKYILYVEGHCAANRYAFLMRLGSVILKVESRCVADEMWYYPILKP
FEDHVPIKADLSDLAEKIRWCRENDEKCRQIAARANELYEKFVSKEAIHDYMEVICNRVA
QRFQTAPKWYTRPEDIDLMKKPDFGRCRGMCVGGATPRYCKRCLEMKEDDDETRAKREHE
REDTRDNNRGDYSYNGYGRDRGRDRDHARDRYSRSDSRGGDYDRRDRGYGVSDRDRHSRE
GRSRERSPKRPRIQQCRKCRRAKSACQCSFRGR

Enzyme Prediction     

No EC number prediction in PPTG_13490-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	252	597	5.2e-30	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.51e-26	252	592	2	242	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.16e-16	389	615	154	332	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
237171	PRK12678	8.90e-07	648	726	196	271	transcription termination factor Rho; Provisional
403927	PRP38_assoc	1.03e-06	640	728	10	97	Pre-mRNA-splicing factor 38-associated hydrophilic C-term. This domain is a hydrophilic region found at the C-terminus of plant and metazoan pre-mRNA-splicing factor 38 proteins. The function is not known.
273727	U2AF_lg	2.67e-06	647	744	3	97	U2 snRNP auxilliary factor, large subunit, splicing factor. These splicing factors consist of an N-terminal arginine-rich low complexity domain followed by three tandem RNA recognition motifs (pfam00076). The well-characterized members of this family are auxilliary components of the U2 small nuclear ribonuclearprotein splicing factor (U2AF). These proteins are closely related to the CC1-like subfamily of splicing factors (TIGR01622). Members of this subfamily are found in plants, metazoa and fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26993.1|GT0	0.0	1	752	1	761
CCA22368.1|GT0	7.08e-180	2	647	4	604
ARF10830.1|GT90	6.32e-108	33	599	24	505
UPA43649.1|GT0	1.75e-66	131	593	99	491
UPA43811.1|GT0	1.75e-66	131	593	99	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.33e-12	252	593	94	332	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O55767|VF179_IIV6	6.89e-66	93	605	49	527	Uncharacterized protein 179R OS=Invertebrate iridescent virus 6 OX=176652 GN=IIV6-179R PE=4 SV=1
sp|Q197C5|VF179_IIV3	3.70e-57	36	603	7	493	Uncharacterized protein 035R OS=Invertebrate iridescent virus 3 OX=345201 GN=IIV3-035R PE=4 SV=1
sp|Q6GZU9|027R_FRG3G	5.88e-36	135	639	42	475	Uncharacterized protein 027R OS=Frog virus 3 (isolate Goorha) OX=654924 GN=FV3-027R PE=4 SV=1
sp|G5E897|PLGT3_MOUSE	9.70e-15	480	631	348	493	Protein O-glucosyltransferase 3 OS=Mus musculus OX=10090 GN=Poglut3 PE=1 SV=1
sp|Q7Z4H8|PLGT3_HUMAN	1.73e-14	390	623	304	489	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_13490-t26_1-p1.