CAZyme Information: PPTG_12938-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_12938-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1016		115650.61	7.2536

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669594:560159-563209(+)

Full Sequence      

MFNKDQSAAAVPPTDDYEMYATPSAMDVQPGEAEIVRRGGSPDPPERRPVNSDENGSFQE
NVITVHGYMHKQGKRTIKGPMHKSWKRRYFALEKAKIYYFHSHLECRQYFTTRNTDLVVG
AIELKDALQLRPCARLDLPHRGFEVMTKRRVWVLCPETDEEYRLWFEGVEEAIVACGSGN
IIERKLPNVRKYYMKGITTYRTLYFLFLILSIVEIFGFVFWFVVGIQPCDSSNRTLACED
VYDNSPDDLSCLADPMSGWFTPPDWYMTLAGVDDVVCFHDPPIAQWVSFFALIAAELVSI
VLGALYYLGMWKPVRRGAHYFDEFDPKVPDDLWPKIDVLLCHYSEPAEETIDTLMACMNL
QYPPHLLQIYVLDDGYCSTKWTKGNPVPAIELNKVVLEKSGDLRQEVAQFMYDRVCDPNE
DMEVYAWRKLHSSANLPSASRPKVVNRADCAVGSFRDDYRYPGLPHVTFIGRVKPETNYS
KAGNINNCLYNEGANGRYMLLLDSDMQPHPKFILATLPFFFDDEDRQFKNKYSCSCMGCQ
NVAKMCCASCKIAGVPEERISYCSKECFENAMHVQSDLHRRQVNGTLSDVRATKKELRCM
NCDSKLGKSGVCRKCNTNNNNGDADMSILHTYSDDVRDNAVGFVQTPQYFRDCVQLQIGD
PLGHRNATFYDAIQTGQDGYDCASFAGTNALIRREALDSIGGIQYGTLTEDCYTGERLVS
MGWKALYFRKDFEGEAQERIRLAEGLIPDSVAGAMAQRKRWAKGNFQTALMKKNKNVADP
EWKRPHVDIPKYRKPNNFMRRVFYLNSTLYPIDSIPVILLYYITLYFLYTGYAPIFVNGL
RVLVALVPKLIVQGLLSAMSTRGVENSDVVRSQETRFVYAFTNFTAMLGAIVWKFTGRKS
RWLNKRDATRGSLAELPNVLVFSGAVFGIIWAMVRYIVAYYNRVYSHGDSMLCAAILMGF
FIAYNLGPSVRMSIQEYFGWSYQSLMDQGNFMGSISIAIGLMFIALWVHVEKPATG

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	636	836	2.4e-16	0.8375634517766497

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	4.79e-40	334	769	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	1.33e-20	637	843	366	554	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	6.55e-16	638	767	111	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	5.60e-13	623	895	145	391	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	1.02e-12	623	829	6	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXF53808.1|GT2	0.0	1	1016	1	1016
ABP96902.1|GT2|2.4.1.12	0.0	1	1016	1	1016
UOI87916.1|GT2	0.0	1	1016	1	1015
ABP96906.1|GT2	0.0	1	1016	1	1013
UIZ24308.1|GT2	0.0	1	1016	1	1013

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.14e-16	636	807	252	401	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.76e-16	636	807	264	413	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.76e-16	636	807	265	414	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.21e-14	636	976	378	692	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.62e-22	465	882	584	878	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	3.79e-15	636	924	254	520	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	8.65e-15	636	767	256	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	5.83e-14	636	767	254	379	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	1.13e-13	636	976	378	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000001

TMHMM  Annotations     

Start	End
203	225
286	308
802	824
834	856
877	896
916	938
951	973
988	1010