CAZyme Information: PPTG_12901-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_12901-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		42727.00	9.5783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669594:474835-476040(+)

Full Sequence      

MQIFRFVIVAIAAFAMQGTQALSTGTAPGLAAGTTGGGNANPVYPTSLAELRNYLKDSQP
RVIVLKTTFDFRGTEGTTTENGCRPKSNRDCLAKNNGYKGQDVILQSGGMANTGGCVEGT
SVKVTYDLAATKNPLVITSNKTLRGVGTSGVIKGKGLWIQGDNVIIQNVHITQLNPHLIW
GGDAIYIQGLNSGKTAMQRVWIDHVKISNIGRQMIATNTASVKSLTISNSEFDGKTQYSA
TCDGNHYWTFLFLGTQTQASLVNNFVHHTSGRSPKVGGNSVIHAANNYWYSNSGFSYDVV
ENGNVLLEGNYFESTAVPNKHDAETVGAIIVPSSSTQSTCKSTLGRNCVENKLVKCGTLS
GNRDSAALANSKKVASYYQPTSAQKLSTNNQNYGVGILSSK

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	313	3.4e-78	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.49e-31	122	315	2	189	Amb_all domain.
226384	PelB	1.83e-12	97	398	51	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.05e-11	132	312	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19251.1|PL1_4	1.27e-268	1	399	1	399
ACR19247.1|PL1_4|4.2.2.10	1.80e-268	1	399	1	399
ACR19255.1|PL1_4	1.04e-267	1	399	1	399
ACR19252.1|PL1_4	5.15e-239	1	396	1	430
AHX74067.1|PL1_4	9.95e-230	1	396	1	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.93e-79	24	365	4	327	Pectin Lyase A [Aspergillus niger]
1QCX_A	3.20e-75	25	394	5	358	Pectin Lyase B [Aspergillus niger]
1IDJ_A	6.38e-75	24	365	4	327	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	2.47e-95	24	398	25	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.47e-95	24	398	25	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.73e-93	29	364	29	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	6.03e-90	25	400	25	384	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	6.03e-90	25	400	25	384	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999785	CS pos: 21-22. Pr: 0.9813

TMHMM  Annotations     

There is no transmembrane helices in PPTG_12901-t26_1-p1.