CAZyme Information: PPTG_12682-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_12682-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		84667.54	4.5523

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669595:344264-346591(+)

Full Sequence      

MLKSWFAAVCCLAISLTGTPLVAADEWDAQTDVIIESMDEDQLVGQMVQVAFSRFFNKDK
TFDEDKFRAYAKLKIGSYLSGPWQSGSYNGKYAWTAQEWRDVLSRAQEIVKEENDGHPFI
FGIDSLHGAGFTSGAVLFGQPINGAATFNPDLAYEMGRIAGRDTLAAGTPWIFGPMLEIS
QNPLWPRVYETFGEDPVLVSAISESLIKGIQSNNGSAACMKHWIGYSKTPTGHDKDPVTL
SDYDLLNYFLPPFKAAIDAGVMSAMENYISVNGIPTIANTKLMNKLLREDMGFEGMTVSD
FAEIEHLNTWHRFARTNEEAATLSIKRTSIDMTMASSDYGFINATKALIAQDPSYLNRVK
ESARRVIKLKLQLGLYDNAVPGADLVDQVGSDEDKAAALNSARESIVLLQNNDSVLPIPE
TAKVFLTGHSADNVGFQCGGWSLSQQGYSGNDMFPNGISVKDGFQAISNETLTYFNGLNY
TGVYNESDLAQAKEYASQAAYTIAVIGEHSYTEKTYGDINDLALPAGQIKYVSELAATGT
KVIVVLVGGRPRLLGELPSNVHAVINAMLPCELGGQAIAEIIYGRVNPSGRMPITYPKDA
GNILMPYNHLVSTQCATGYCEMQWEFGHGLSYTDFTYSDMTLSRTNVTSITETVDVSVVV
TNSGTVAGKETVMLFLTQPFRTISVPEVKQLKKFTKVDLKAGESTTVKFTLSADDWSVYY
PQIGSGLKKVAEDADYVVAIKPETDCDVYNETAVANPLCATFTLQTGEHPYGSFE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	334	3.1e-58	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.03e-108	118	740	105	750	beta-glucosidase BglX.
224389	BglX	1.17e-64	41	451	4	381	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.17e-58	118	711	83	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.80e-50	41	369	3	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.86e-46	406	632	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	2.62e-314	1	764	1	762
UIZ29613.1|GH3	3.51e-282	1	770	46	825
UIZ27116.1|GH3	4.65e-280	47	765	1	725
UIZ29432.1|GH3	7.64e-280	1	770	1	769
CCA27737.1|GH3	2.23e-279	12	764	41	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.21e-114	17	715	2	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
7EAP_A	6.45e-80	101	718	79	726	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	8.94e-80	101	718	79	726	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXL_A	5.61e-78	26	740	9	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.85e-77	26	740	9	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	8.68e-128	28	740	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	7.83e-116	1	715	8	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	3.71e-76	102	747	50	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.00e-73	100	714	87	728	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	5.04e-72	100	714	87	728	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999689	CS pos: 24-25. Pr: 0.9325

TMHMM  Annotations     

There is no transmembrane helices in PPTG_12682-t26_1-p1.