CAZyme Information: PPTG_12235-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_12235-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48214.58	9.3565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669588:288593-289956(-)

Full Sequence      

MERRVIVFAAATRACVTLLALATSAIVTPYDTSSHLQAGDSSFAALSNWDGVYFSHIALS
GYDFEHFHAFFPLYPLLARWFARLLPLETSAAVIISGWLISNVSFVLAALFLYRLGCVVL
RDEVVARRAAYLFCVAPSSIFMSAVYSESLMCLLSFSGMYFLARHAQAVKTRRSFRDLVL
CALLFGAASATRSNGILLSLFIAWHRVTVSPPPREVFRFLGFWIRTAALGVLAIGPQLVY
FVTSMLPYCPSLVRRFGWEVSGTGEVEDRSWCFDAVPNLTAMYTFVQSEYWNVGLFRYYE
LKQLPNFILAAPILVLSLHALHGYFRGNVVPGKSIVTQGHGWRGTALTPYYVHWLFMVIN
ALLVAHIQVTTRLLCACPPLFWHPASLMCDSTVKRKSSTVLTRYGRLVVGYFLLFTVLGS
VLFPSFYPWT

Enzyme Prediction     

No EC number prediction in PPTG_12235-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	6	430	1.6e-107	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.52e-52	5	430	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.29e-16	46	321	71	316	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	1.45e-252	2	430	6	439
CCA18790.1|GT76	1.27e-121	2	430	6	490
ACO67127.1|GT76	4.41e-61	13	430	13	421
BBN03197.1|GT76	6.36e-56	49	430	84	482
CAG1859610.1|GT76	3.08e-52	29	430	38	505

PDB Hits     

PPTG_12235-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	5.64e-39	37	430	54	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q290J8|PIGV_DROPS	3.97e-38	42	430	59	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	9.25e-36	39	428	71	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	1.23e-35	37	430	54	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	2.37e-35	37	430	54	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.675128	0.324877

TMHMM  Annotations     

Start	End
5	27
56	78
91	113
140	162
182	204
219	241
306	325
345	367
404	426