CAZyme Information: PPTG_11900-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11900-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913		103511.66	6.7295

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669585:680811-683552(-)

Full Sequence      

MSGAPPPSSGFQPRSMGLPPLSQGPRSSMMSVEYDGIPLPPPSIRSCGSQQYVTSYIPTG
AAFPSGSVQDLISSMKSYASATDLVRTYSEIPSVEEALVTLDRAAVALGARRYRDALKLY
LEGGYAMANVAERQANPKICNLLTSKGFETLNWCARLCDWIEGRIKEKHPRPGVHKVGIP
VSNWDEDWVGPYLDEEEARRMWYTPVYCPHPIDFSNLGYRLRCVETGRRPRLMICITMYN
EGPQQLKATLKKLANNLAYLKEQKKDHEKTLSRDFAGEDVWQNVLLCIVADGREQINDKM
LDYLEAIGLYDEDLLTINSAGIGAQCHMFEHTLQLNVNGKSLLPIQTVFALKETKSSKLD
SHHWYFNAFAEQIQPEYTAVMDVGTMLTKSALYHLLFAFERNHQIGGACGQLTVEKPFEN
LSNWVISAQHFEYKISNILDKSLESCFGFISVLPGAFSAYRYEAIRGAPLDAYFQTLNVD
LDVLGPFIGNMYLAEDRILSFEVVARKDCKWTMHYVKDAVARTDVPHDLVGLISQRKRWL
NGAFFATLFSIWNWGRIYSESNHSFTRKTAFLVFYLYHLLYTAFTFFLPANLYLALFFIV
FQGFQQNRLEFVDTSEYSQTVLDCAVYIYNFVYLFGLLMLIIIGLGNNPKHMKLTYYFVG
AVFGVMMMLSSLVGLGIFFSTPATVHSIVVSILTVGVYFIGSALHGELHHIFMTFTHYTA
LIPSFVNIFTIYSFCNLQDLSWGTKGLHDDPLLAASLDDTEKGDFKDVIAKRRAMEERRR
EENERVENRKKNFEAFRSNILLTWTFSNLIFALFIVYFADSSTYMPILYIFVASINSCRL
LGCIGHWIYIHTAGLRESFLDKSECGNGTGRYPQNSYVQLDEHYAALAEDQRTYASGRTN
ASVRTINEVSSVV

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	238	399	3.2e-50	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	8.47e-67	234	546	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	8.93e-59	238	399	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	2.67e-23	366	695	129	417	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	1.35e-19	376	541	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	1.06e-17	348	466	56	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGT99185.1|GT2	0.0	1	913	1	913
ARC77247.1|GT2	0.0	1	912	1	912
ARC77246.1|GT2	0.0	1	912	1	912
ARC77248.1|GT2	0.0	1	912	1	912
ARC77245.1|GT2	0.0	1	912	1	912

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	3.12e-11	93	161	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	1.50e-127	144	801	155	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	1.95e-107	191	842	332	1019	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|P87073|CHS1_PHYB8	3.94e-107	191	810	128	787	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	2.20e-105	191	809	145	807	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|J9VMX7|CHS7_CRYNH	1.02e-104	163	808	144	834	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

Start	End
579	601
624	646
656	678
685	704
714	736
795	817
827	849