CAZyme Information: PPTG_11791-t26_2-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11791-t26_2-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1457	KI669585|CGC1	162678.89	5.4240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669585:313689-319246(+)

Full Sequence      

MGLFGKKGNGSRVAEGGGGALAAASPLTTASPLKGKSGDLELFGADSDDSDDDATIDRYA
KDGGDEEMDEKEAAEAEKRKVAVLNSKLSPEDLFKKYDTDGSGNISAPEFLAMLPDLGIS
ISAAKAMRIFRKCDTDGGGEIDLTEFKMAMFAVDPVSGNPLGFSPSTLLGPRDAFELFDE
DGTGQIDELEFADVLEYFGMDVSDEKQEKIFKKYDKDKSGHIDYQEFRSMWIKLVDVREE
LTKRGVEVPKHTRLVKLQQMLETILDEEEAREAAALEEAKRFLQRQRDKELREQLGRKAI
VRAEDELAAALDAAGQVYIIGSGKYDQFIDDPVTRDEDLFPGFKAVSEIWSYRVNPIIQE
VHTIKPKAATTDHKQAKDTELSPEAANKSAPKNQEVKNTDPPPGNQLNAPASKYVRRRVE
NKRWKFQSPPRLNKQTISETKILIRAISREMDNANERNDGEKGAVNSPTNSSEVVEITHD
ENNQEEEELAKLFFENREFVRSLRFRSTTLMTNTGPLWGKSVVQGAISDSVAFAVTSSGS
VFSWGGRSSTWEASNRRVSGFDSDSDDSIDDTGQEKDKKISEFGMQTKVTPRSALQKMCT
PEQLEGLRDPDVEAREEVLLEIEARQNEENQRYERLKRVAMYYDVWEPPPSNATRLLFME
QVVLPKIEYEQLVTSGQLRGLEFQKITKMDLSLALGECFELEIEVKGEAGHAAFKEMERV
INEYSQDKKRIQEKQTNMLQAEKDKMLQEWQDVKTLRESRHAKEEEDARARVIEKINRAD
RAYESRAARRVVQMEDMVPEFTTRGENSRIEMSGITTRGPPLHSPRGSIAIASVSAGGSH
VALLTQDGSLYSCGIGSSGRLGLQPNERGANCFDSNHPQRVQAFNGLNLRQVSCSFSHSA
AIDSEGSLYTWGSACTGKLGVGIVEDEYKQYSMTPLLVKFPGKRRIRSVSCGPSHTGAVS
TAGELFMWGSANGGRLGLGQHVIDIVVVPTLVRDLVNKKIRVWQVSCGTAHSAFCTEVTS
EFNGGSKKLLGGQVYVCGGATALSRYVLSWERIPQLDGVGVRQVSCGGSHTAAVSSYGEL
YTWGRNYHGCTGHDASRRFIEKPELLKCLHVEPYNLALGKICRQISIYNEQGPQLAVNGD
IEGALATCTHTQMEDKPWWEVDLGQPAVIEKIRLWNRTDEPLNPSKSRSEYSGRLFPCWV
FVSEFAFKDLEGKEGLRAAKVQSSAFELFRTNKRMTEWILPTANAVGQFVRVQLQNKNFL
HFAQVEVFGVYSAFKYVGKVGAVQCSTDATLVIMSPISTQSVLDDYYLRAIQADADHASI
LRQYDAYERSFRKFGRGTAETLDGPCRLCRVFRDCEICEFYASAKYSRRAASDNGQKPLP
VRLVGDRMGLKELVQVAMAEGTLEAEQQEQLRQEQEAADIAREAEAERQRAEEQERNKRQ
SRLLNPFQGLNFRNKKT

Enzyme Prediction     

No EC number prediction in PPTG_11791-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1125	1264	1.4e-18	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	1.01e-27	817	1093	94	374	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	1.45e-19	81	233	7	156	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
227511	ATS1	8.28e-19	814	1098	34	323	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
238008	EFh	5.17e-16	172	231	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
320055	EFh_PEF_Group_I	2.48e-15	125	229	1	91	Penta-EF hand, calcium binding motifs, found in Group I PEF proteins. The family corresponds to Group I PEF proteins that have been found not only in higher animals but also in lower animals, plants, fungi and protists. Group I PEF proteins include apoptosis-linked gene 2 protein (ALG-2), peflin and similar proteins. ALG-2, also termed programmed cell death protein 6 (PDCD6), is a widely expressed calcium-binding modulator protein associated with cell proliferation and death, as well as cell survival. It forms a homodimer in the cell or a heterodimer with its closest paralog peflin. Among the PEF proteins, ALG-2 can bind three Ca2+ ions through its EF1, EF3, and EF5 hands, where it is unique in that its EF5 hand binds Ca2+ ion in a canonical coordination. Peflin is a ubiquitously expressed 30-kD PEF protein containing five EF-hand motifs in its C-terminal domain and a longer N-terminal hydrophobic domain (NHB domain) than any other member of the PEF family. The NHB domain harbors nine repeats of a nonapeptide (A/PPGGPYGGP). Peflin may modulate the function of ALG-2 in Ca2+ signaling. It exists only as a heterodimer with ALG-2, and binds two Ca2+ ions through its EF1 and EF3 hands. Its additional EF5 hand is unpaired and does not bind Ca2+ ion but mediates the heterodimerization with ALG-2. The dissociation of heterodimer occurs in the presence of Ca2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARF18102.1|CBM48	3.19e-15	831	1089	91	326
ARF14915.1|CBM48	1.11e-13	831	1089	93	328
QQX77088.1|CBM47	4.80e-13	1115	1269	203	340
UCA56570.1|CBM47	4.80e-13	1115	1269	203	340
ARD48911.1|CBM48	7.57e-13	831	1089	106	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XZM_A	1.28e-28	821	1112	105	372	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZM_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
6XZN_A	1.28e-28	821	1112	105	372	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZN_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
4DNV_A	2.97e-28	821	1112	102	369	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4DNW_A	3.19e-28	821	1112	102	369	Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNW_B Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4NAA_A	3.36e-28	821	1112	101	368	Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_B Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_C Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_D Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NBM_A Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_B Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_C Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_D Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],6DD7_A Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_B Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_C Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_D Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F2Z461|HERC6_MOUSE	4.34e-28	822	1089	15	265	E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
sp|Q9FN03|UVR8_ARATH	4.71e-27	821	1112	113	380	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
sp|Q8IVU3|HERC6_HUMAN	1.04e-25	831	1096	25	273	Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
sp|Q9VR91|HERC2_DROME	7.40e-25	805	1104	2992	3275	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|Q4U2R1|HERC2_MOUSE	1.27e-24	805	1185	2966	3351	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

There is no transmembrane helices in PPTG_11791-t26_2-p1.