CAZyme Information: PPTG_11791-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11791-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein, variant 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1319		147191.86	5.4794

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669585:313689-318720(+)

Full Sequence      

MGLFGKKGNGSRVAEGGGGALAAASPLTTASPLKGKSGDLELFGADSDDSDDDATIDRYA
KDGGDEEMDEKEAAEAEKRKVAVLNSKLSPEDLFKKYDTDGSGNISAPEFLAMLPDLGIS
ISAAKAMRIFRKCDTDGGGEIDLTEFKMAMFAVDPVSGNPLGFSPSTLLGPRDAFELFDE
DGTGQIDELEFADVLEYFGMDVSDEKQEKIFKKYDKDKSGHIDYQEFRSMWIKLVDVREE
LTKRGVEVPKHTRLVKLQQMLETILDEEEAREAAALEEAKRFLQRQRDKELREQLGRKAI
VRAEDELAAALDAAGQVYIIGSGKYDQFIDDPVTRDEDLFPGFKAVSEIWSYRVNPIIQE
VHTIKPKAATTDHKQAKDTELSPEAANKSAPKNQEVKNTDPPPGNQLNAPASKYVRRRVE
NKRWKFQSPPRLNKQTISETKILIRAISREMDNANERNDGEKGAVNSPTNSSEVVEITHD
ENNQEEEELAKLFFENREFVRSLRFRSTTLMTNTGPLWGKSVVQGAISDSVAFAVTSSGS
VFSWGGRSSTWEASNRRVSGFDSDSDDSIDDTGQEKDKKISEFGMQTKVTPRSALQKMCT
PEQLEGLRDPDVEAREEVLLEIEARQNEENQRYERLKRVAMYYDVWEPPPSNATRLLFME
QVVLPKIEYEQLVTSGQLRGLEFQKITKMDLSLALGECFELEIEVKGEAGHAAFKEMERV
INEYSQDKKRIQEKQTNMLQAEKDKMLQEWQDVKTLRESRHAKEEEDARARVIEKINRAD
RAYESRAARRVVQMEDMVPEFTTRGENSRIEMSGITTRGPPLHSPRESYVVIELHVITCG
MLFRRSLYSCGIGSSGRLGLQPNERGANCFDSNHPQRVQAFNGLNLRQVSCSFSHSAAID
SEGSLYTWGSACTGKLGVGIVEDEYKQYSMTPLLVKFPGKRRIRSVSCGPSHTGAVSTAG
ELFMWGSANGGRLGLGQHVIDIVVVPTLVRDLVNKKIRVWQVSCGTAHSAFCTEVTSEFN
GGSKKLLGGQVYVCGGATALSRYVLSWERIPQLDGVGVRQVSCGGSHTAAVSSYGELYTW
GRNYHGCTGHDASRRFIEKPELLKCLHVEPYNLALGKICRQISIYNEQGPQLAVNGDIEG
ALATCTHTQMEDKPWWEVDLGQPAVIEKIRLWNRTDEPLNPSKSRSEYSGRLFPCWVFVS
EFAFKDLEGKEGLRAAKVQSSAFELFRTNKRMTEWILPTANAVGQFVRVQLQNKNFLHFA
QVEVFGVYSAFKYVGKVGAVQCSTDATLVIMSPISTQRCVQLQYNAVSISTSLSLQRAG

Enzyme Prediction     

No EC number prediction in PPTG_11791-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1122	1261	1.2e-18	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	1.87e-22	837	1104	187	440	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227511	ATS1	2.55e-21	847	1090	125	374	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	1.17e-19	81	233	7	156	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
227511	ATS1	2.37e-16	846	1095	69	323	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
238008	EFh	3.88e-16	172	231	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQX77088.1|CBM47	4.23e-13	1112	1266	203	340
UCA56570.1|CBM47	4.23e-13	1112	1266	203	340
AMX03783.1|CBM32|CBM47|CBM6	2.13e-12	1109	1279	144	305
QOX79078.1|CBM47	2.99e-12	1112	1266	131	272
ACD95713.1|CBM47	6.88e-12	1018	1266	30	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XZN_A	6.49e-25	832	1109	112	372	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZN_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
6XZM_A	6.49e-25	804	1089	33	301	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZM_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
4O2W_A	1.39e-24	824	1123	118	393	Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_B Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_C Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_D Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens]
4DNV_A	1.51e-24	832	1109	109	369	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4DNW_A	1.61e-24	804	1089	30	298	Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNW_B Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F2Z461|HERC6_MOUSE	1.70e-26	847	1086	43	265	E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
sp|Q8IVU3|HERC6_HUMAN	4.59e-25	841	1093	38	273	Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
sp|Q9FN03|UVR8_ARATH	2.06e-23	804	1089	41	309	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
sp|Q15751|HERC1_HUMAN	1.82e-22	824	1123	4074	4349	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
sp|Q4U2R1|HERC2_MOUSE	2.38e-22	805	1182	2966	3351	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

There is no transmembrane helices in PPTG_11791-t26_1-p1.