CAZyme Information: PPTG_11777-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11777-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	KI669585|CGC3	90142.70	6.1553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669585:289155-291569(-)

Full Sequence      

MTRSNAFCLLGVCLLMLLGFKEVVASVARLKKDAEPHDPVAATRGLIHRRLGGKYNDQIS
LRVLPSDADDLDVFELGSDGDKLEIAANSATAMAYGLQWYFKSVLRTQTDWDNHKLQLPD
KLPKVEERVRHKRSSKFSYYQNVDTGSYSLWAWTWPQWEKHIDWMALNGINMPLAFTGQE
KVWQNTFHKYYNVSYEGLGKFFAGSAFLSWGRMGNLRGSWVKGPLPQAFIDNQHELQLRI
LQRMREFGMIPALPAFAGHVPEELKLRLPNANFTQSPNWGNFSEEHCCVYMIEPTDSLYR
EIGKNFLKEQRALYNYTSSLYQCDTYMEMTPEFTDLEELKGAARVVIDGMTAADPNAVWL
MQGWPFVDDPHFWTKPRVKAYLDGVPTDKLIILDFYSESVPIWNKMDNYFGKNWIYCVLH
NFGGNTGMRGDLPTLATAPVQASWAGNGTMVGVGLTMEGIFQNYIVYDLTLQMAWVDTPL
DVNNWVSRYAAQRYHTHNEHVEKAWNYLLRSVYNRTMAYGGVTKSLVCLIPRWRLLYDRF
QPTLIKYDPNDVVLAWKELLLAGKELCDVDTYRHDLVDVTKQFLSNKLLEQYIHLKAVYN
AKKASSKEVCGLTKTMLTTMERLEEILATSEDFLLGNWIGDALALAGDLSEGEDKVTRTK
LQEYYEYEARNQVTRWGDNNNEAIHDYAGKEWAGLVKGYYIPRWTMWLSEVCNAYTDKRE
MDEKTLKEKRIAFELKWQLSHESYPTTTVGDSFTVSKRFYSEYIASTDLIPWELFGEILS
VA

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	80	760	1e-214	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.06e-178	139	475	2	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	5.60e-91	485	757	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	4.87e-22	41	123	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55486.1|GH89	7.14e-296	37	769	22	735
AIG56008.1|GH89	2.20e-295	18	767	6	742
AIG56414.1|GH89	2.55e-242	16	766	12	751
AIG55749.1|GH89	2.44e-225	37	763	28	748
AIG56322.1|GH89	1.78e-219	37	763	30	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	9.95e-149	41	763	7	711	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	6.04e-86	44	709	175	822	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.90e-86	44	709	183	830	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.18e-85	44	709	198	845	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	2.67e-166	41	763	47	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	1.00e-147	41	763	30	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999749	CS pos: 25-26. Pr: 0.9738

TMHMM  Annotations     

There is no transmembrane helices in PPTG_11777-t26_1-p1.