CAZyme Information: PPTG_11754-t26_2-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11754-t26_2-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		79212.94	5.8679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669585:178177-180294(+)

Full Sequence      

MAYGLQWYLKTVLHTQTDWDNHKLQLPYVLPKVKQHARHKRSAKFSYYQNVCTVSYSSWT
WGWTQWEKHIDWMALNGINMPLAFTGQEKVWQNTFQKHYNVSSAGLNKFFAGSAFLAWGR
MGNLRGSWVKGPLPQAFIDSQHALQLKILSRMREFGMIPALPAFAGHVPEEIKVLFPNAK
FTRSPNWGNFSDEFCCVYMLDSSDPLYYDIGKTFLEEQRALYDYTSSLYQCDTYNEMDPD
FTDPAKLQAASRAVIDSMTAADRNAVWLIQGWLFENSPDYWTKERVKAYLDGVPDDKMII
LDLYSEVRPVWNKMDNYFGKSWIYCVLHNFGGNTGMRGDLPTLGTAPVLANRDSNGTMIG
VGLTMEGIYQNYVVYDLTLQMAWVDTPLNMDEWIPSFAAQRYHSLDAHTERAWGFLLQSV
YNRTLGFGGVTKSLVCLIPHWKLVRDGFMPTSITYDPMDVTRAWKELLLAGSELHAVDTY
RHDLVDVTRQFLSDHFMAQYLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNED
FLLGNWIADARALAEDIETIDSSNLQDYYEYEARNQVTRWGDNNSEAIHDYAGKEWAGLV
KGYYLPRWRMWFGEVCQSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVS
QRIYDEFAGLDVVQPWASQLVMQE

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	1	664	1.5e-218	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	47	383	2	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	6.76e-100	393	661	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	8.22e-07	1	31	51	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56008.1|GH89	1.49e-309	1	668	81	739
AIG55486.1|GH89	2.16e-301	1	668	78	730
AIG56414.1|GH89	9.00e-243	1	669	88	750
AIG56322.1|GH89	1.55e-218	1	667	86	747
AIG55749.1|GH89	1.18e-215	1	681	84	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	7.49e-159	2	676	63	720	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.40e-77	1	657	224	866	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.57e-77	1	657	232	874	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.34e-76	1	657	247	889	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	1.32e-169	1	667	105	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	7.66e-158	2	676	86	743	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PPTG_11754-t26_2-p1.