CAZyme Information: PPTG_11326-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11326-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		56980.36	4.6166

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669584:286670-288217(+)

Full Sequence      

MTAFDGVLLETLGVNDKPCDEAVIEVELGQEVEVRVTNELHDASCLHWHGMKQLGTQEMD
GVSGITQCFLEPNTTAVYRFKPDKAGTFWWHSHHKTQYAFGLRGPLIVHAPASDLRDCEK
EIDEEFTVQLAEIYHTVPALTGPVLWDTIAINNRGRFNCTAAALNNLTECSTDQPLSNFY
FKAGKKYLLRLINMAAQAPFEFSIDDHEFQIIAADGEPVQPTELINSIFINAGQRYDIAV
QGKNDTQGVDSFWMRAKGMTGLPWMARAADTGLPGFNAEGLAIVRYNAANTSEPTTQKCE
EVVTMSEFDFTPETMAALPTTASDRSIIQFDIIPKAGGIVSIDGGEYHSLVIPDEPPLFT
ISNGSTTADLPFTANARAIEYGKHVEVVLVNNMNEQHPFHLHSHAPWVVGSGQATAEDIY
NNNLPPLKLVGAMMRDVYTVPPCDTDENNYCVNLGYLVLRFIADNPGVWIMHCHIDWHMD
IGLSMIFVEGEKELQHKGPNAFSNSLLSVCKRTSA

Enzyme Prediction     

No EC number prediction in PPTG_11326-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	22	483	2.7e-90	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.77e-64	24	490	34	524	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	1.77e-55	24	490	57	547	oxidoreductase
177843	PLN02191	2.59e-53	24	490	56	547	L-ascorbate oxidase
225043	SufI	3.83e-52	23	491	65	450	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
274556	laccase	1.22e-42	24	488	36	518	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	2.47e-239	4	514	39	548
UIZ26488.1|AA1	4.83e-223	2	510	28	536
UIZ26495.1|AA1	3.11e-188	2	510	36	561
AFY09915.1|AA1	6.68e-188	2	510	34	565
AIG56347.1|AA1_2	1.40e-78	5	498	56	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z1X_A	2.05e-68	23	509	35	486	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
1HFU_A	4.33e-63	33	489	45	468	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	4.43e-63	33	489	45	468	Chain A, Laccase [Coprinopsis cinerea]
5EHF_A	5.66e-61	23	489	35	467	Laccase from Antrodiella faginea [Antrodiella faginea]
3SQR_A	2.26e-60	5	497	82	550	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01679|LAC1_PHLRA	1.15e-63	29	489	62	490	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2
sp|J9VQZ4|LAC2_CRYNH	1.08e-60	23	509	93	593	Laccase-2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LAC2 PE=3 SV=2
sp|Q12717|LAC5_TRAVE	1.08e-59	29	499	64	507	Laccase-5 OS=Trametes versicolor OX=5325 GN=LCC5 PE=2 SV=1
sp|Q12729|LAC1_PLEOS	5.94e-59	23	489	67	498	Laccase-1 OS=Pleurotus ostreatus OX=5322 GN=POX1 PE=2 SV=1
sp|Q99056|LAC5_TRAVI	7.95e-59	29	499	64	507	Laccase-5 OS=Trametes villosa OX=47662 GN=LCC5 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999437	0.000587

TMHMM  Annotations     

There is no transmembrane helices in PPTG_11326-t26_1-p1.