CAZyme Information: PPTG_11319-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11319-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		62926.16	5.3489

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669584:266537-268261(+)

Full Sequence      

MGLLSTLSFLLLSATQASARVVRYDWNITTLNTTIFDGVRGKFGYGINNELADLHPINVT
FGDEVEVHVTNKLTEQTCLHWHGLRQFGTQEMDGVSGITQCQIQPNVTAIYRFKPDKCGT
FWFHGHEEVQYAYGLRGPLIVHCPPKLQQSWEKDVYKEYTIMLTDWYHDLPVGAPIWDTV
LINNVGRYNCTVAEAAGFECGPGRPLPRFQFVPGKKYLLRLINTSAMAAFKVSIDGHTFQ
VVASDADYLKPSTPVNSVTINVAQRYDILVQAKSSASQGQGQGQSQSQKQGQTGGKNTAL
GSFWLRVHSPFGIPWTAREADQVPEGFNPDALAIIDYQAGAKADPTTSAWATEVTIGEFD
YNPAVPVTLPTAPDQRIVAEFTLGVLAPNPTAFLGYMALDGGDFSSLVIPDSPPLFTIAQ
GAKTEELPTTANAIKLKHNDHVEVVVVNETPDQHPFHLHAHSPWIVGSGHASRDNILAGN
VTALRLNGPMQHDVFTVPECMTDADGACTDLGYVVFRLNADNPGVWLMHCHIDWHFVLGL
AMLFVEAEDVLHDEGLGAFSSNMLMSVCNGNFTL

Enzyme Prediction     

No EC number prediction in PPTG_11319-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	56	541	1.2e-84	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.34e-63	57	549	34	526	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	2.15e-57	17	566	19	570	L-ascorbate oxidase
215324	PLN02604	2.56e-53	62	546	62	546	oxidoreductase
225043	SufI	2.16e-52	57	548	66	450	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
274556	laccase	8.63e-45	62	545	41	518	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09915.1|AA1	0.0	1	574	1	571
UIZ26495.1|AA1	0.0	5	574	7	569
AFY09916.1|AA1	6.44e-196	13	571	17	547
UIZ26488.1|AA1	9.15e-184	17	571	12	539
AIG55536.1|AA1	2.48e-76	13	556	32	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SQR_A	1.12e-56	61	548	104	544	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
3V9E_A	2.15e-56	61	548	104	544	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
1HFU_A	1.76e-55	63	546	42	468	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	1.80e-55	63	546	42	468	Chain A, Laccase [Coprinopsis cinerea]
5NQ7_A	8.86e-55	62	546	62	488	Crystal structure of laccases from Pycnoporus sanguineus, izoform I [Trametes sanguinea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12570|LAC1_BOTFU	1.10e-62	13	548	52	523	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|J5JH35|OPS5_BEAB2	7.26e-59	57	546	106	551	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1
sp|Q96WM9|LAC2_BOTFU	3.15e-58	57	548	101	545	Laccase-2 OS=Botryotinia fuckeliana OX=40559 GN=lcc2 PE=2 SV=1
sp|Q09920|FIO1_SCHPO	2.35e-56	24	551	27	502	Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fio1 PE=3 SV=1
sp|E9R598|FETC_ASPFU	5.15e-56	9	547	5	493	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999716	CS pos: 19-20. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in PPTG_11319-t26_1-p1.