CAZyme Information: PPTG_11180-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_11180-t26_1-p1
• CAZy Family: GH37
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	KI669586|CGC2	81329.39	7.0556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669586:587580-589984(+)

Full Sequence      

MSPLSTCALLALICVLSFAIRLFPVVIWGSVIHEFDPQFNFRVTKFLAQHGVYELLDWFD
DRAWYPLGRIVGTTVYPGLMAGAAGLQWTLTLVLRLPISVRDACVFLAPVFAALACVAQF
LLTYEVTNSTVTALLSAMLLSVSPAYISRSTAGSFDNEGIAIFLLISTFYLWVKAVKTGA
MLWAALAAVSYFGMALSWGGYVFIINIVPIHVLALLLSGHYSPKIYVAYSTFYPLATLGA
MQVPFIGFNAMIKGENAGSHGVFALLQAYAFMHWLSTQIPRDQFMRLLRTCLRAGATIIG
SGLLLALLLGKLQWSGRSLTLLDPTYASKYIPIIASVGEHQPTVWSAFYFSLGPAMLFIP
LGVFYSFQKLDAAFLFMIVYSTFAFYFSGIMVRLLLTLAPAACYLSAIGASGFMHKIVEL
TRKDPVRAEGTETSNATDGMNKTEAEEEKEDSTRSHSGEIFSAVVAKLRFQPDDGEKQKA
PRALQLLVFACGVLLVIHARHSSNIAKKVYSSTSLVFEKMNMTTKEKDLHDDYREAFAWL
RQNTPEDAKILSWWDYGYQVTTLANRTVLVDNNTWNNTHIATVGRVLTSREDDALPILRS
LDVDYVFLLFGGNVGMPGDDLDKLPWIVKISEGVFPDDVIESEFQVNGRYIFHENATLAM
TESVLYKLSYYEFNQVESQPAKEGENPVLGWDMSRQFRIPTRDIKLRHFEHVFTSDAWMV
RIYRVKR

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	7	677	1.5e-149	0.8513708513708513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	7.53e-92	8	411	5	410	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.62e-60	9	726	21	730	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.04e-23	8	606	2	584	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
404170	PMT_2	2.25e-04	88	228	8	146	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA17694.1|GT66	2.04e-238	9	725	8	741
CCA18340.1|GT66	2.04e-238	9	725	8	741
UIZ23018.1|GT66	4.40e-232	1	727	58	738
CCA15036.1|GT66	1.24e-230	9	727	65	737
CCA23157.1|GT66	1.24e-230	9	727	65	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S7T_A	1.58e-195	17	726	84	773	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6S7O_A	7.17e-191	9	726	22	695	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	1.07e-190	9	726	22	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	1.43e-190	9	726	22	695	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6C26_A	1.15e-166	21	727	32	684	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E2RG47|STT3B_CANLF	5.76e-195	17	726	84	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	8.14e-195	17	726	84	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	2.96e-194	17	726	81	770	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|P46975|STT3_CAEEL	5.98e-194	2	727	17	717	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans OX=6239 GN=stt-3 PE=1 SV=1
sp|Q9FX21|STT3B_ARATH	1.34e-192	8	726	44	729	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998368	0.001687

TMHMM  Annotations     

Start	End
7	29
74	96
103	122
126	148
160	182
197	219
226	248
258	277
290	309
345	367
374	396