CAZyme Information: PPTG_10633-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10633-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		51463.76	4.7401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669582:678409-679834(-)

Full Sequence      

MTWLSVPHYGRYLYRTASKEPFFWQADTAWELIHRLNKTSIDFYLRTRAEQGYNVVQTVV
ISELNGTTRTNFYGDLPFSNSDSTKPNEAYFELVDWTVDLAASYGILIVLVPTWGMYVSG
GWHNFDRIFNESNAYKWGQYIGNRYPGLPKILGGDSNALWSWNMSAVQNAYNENPDQDLV
SVLAPVEDTSSVWSSMRRGLKDSESQHGYDSLVIYHPNNISSFYRHVLASDRLGLDQEVI
DLENHYEGAHDSFDLDKVIWNASHIRTGLYHGVYSGASGFTYGANSVWQMYEPRTALLRD
SDWFPAQINQNESGSWREDIYFEDATQAKYVTKPLSGLSTAVLESLEPARELLSSPSNHT
GKSVNTYEGTRYISILASKILDRFYVYTGHGDSFALDLGDGSRSSRSGSATWLSPRDGQY
YASSTVDVPANNARIDFYPPTTGGIDNDWLLVLEF

Enzyme Prediction     

No EC number prediction in PPTG_10633-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	4	451	1e-69	0.9927184466019418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	7.09e-104	10	338	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.94e-07	369	454	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	6.78e-135	4	454	33	534
KAF3763706.1|GH140	2.12e-127	4	453	32	535
KNX49908.1|GH140	4.19e-61	10	450	22	514
KAE8156220.1|GH140	9.84e-60	10	454	35	508
KAB8225539.1|GH140	1.06e-57	10	454	35	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	3.26e-22	4	293	18	315	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.07e-21	4	293	18	315	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PPTG_10633-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10633-t26_1-p1.