CAZyme Information: PPTG_10629-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10629-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		59191.23	4.4788

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669582:650958-652553(-)

Full Sequence      

MKIQAAIAGLLSFAGLTSTSAEPSWHNLAITAPQYGRYLTRTVSEEPFFWQADTAWELVH
RLNKTSIEFYLKTRAEQGYNVVQTVVVSELNGTTRSNFYGDLPFNNSDPTQPNDAYFELV
DWTVDLAASYGILIALVPTWGMYVNGGWHSTSPIFNESNAYEWGKYIGQRYPGLPKILGG
DSNAMWSWNMSEVQAAYAEDPDQDLPSLLAPIEDTSSVWASMRRGLKEAESTQGYESVVI
YHPTAGWIVKPEVTPEAYGHNMLPDEEDRMSIDAVQSGHATPDPTSKFTPTIGWDSTKNY
EVIANMRDRFTGPVIDLENHYEGAHDSFNLERQIWNSSQIRTGLYHGVYNGASGFTYGAN
SVWQMYEPRSALLRDSDYYAPQINQNASGSWREDVYFEGATQTQYVTKPLQNLTVAVLET
LEPAREVLASPSGHTGKSVNTYEGTRYISVLASKNRDRYYVYTGHGDSFALQLDNGSGAR
SGSARWFSPRDGQYYANATVSVPESGNATRIDFTPPSGGSIDDDWLLVLEF

Enzyme Prediction     

No EC number prediction in PPTG_10629-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	36	500	4.3e-77	0.9368932038834952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	5.56e-121	36	413	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.13e-11	440	530	10	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	8.39e-175	1	530	1	534
KAF3763706.1|GH140	2.19e-164	14	529	17	535
KNX49908.1|GH140	7.42e-80	27	526	13	514
KAB8203844.1|GH140	4.51e-74	10	530	6	508
KAE8156220.1|GH140	1.24e-73	11	530	7	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.33e-26	25	529	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.86e-24	25	529	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PPTG_10629-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000528	0.999457	CS pos: 21-22. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10629-t26_1-p1.