CAZyme Information: PPTG_10601-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10601-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		58788.44	4.5793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669582:556203-557789(-)

Full Sequence      

MKFQTALLSLLNLATTALAQPSWHDLAITAPQYGRYLYRTNSQEPFFWKADTAWELMHRL
NKTSIDFYLKTRAEQGYNVVLTVVLSAYNGTTRPNFYGDLPYNNSDTTQQNEAFFELVDW
TVDRAASYGILIALVPAWGNWISGAWHGTKISIFNESTAYQWGNYLGERYPGIPKLLGGD
TNCIWVRNTTAAMISYAANPNVDPATLLSPVEDTTDLWVSMRTGVKDAEKAEGYEPIILF
HPTAGRIARPVSTPMAYGHLMFPKEGDRVSIDAVQSGHATPDALGGFTPYETWDSTKNYE
LIAAMRDGFTGPVLDLENHYEGAHDNLDANQPMIWNASQIRTGLYNGVYGGAAGYTYGAN
SVWQMYEPASDLYRESDYIVPSSGEDASSSWRKDLFFEGGQQAQYTTKPLQNLTVAELEM
LEPARQLLASPSGYTDVAVNAFASTRYISVLASVNRDRFYVYTGHGDSFSLSIGNGFERT
GNLRRFSPRDGEYYADLTVNVPVNVTRVDFTPPSGGNVDNDWLLVVEF

Enzyme Prediction     

No EC number prediction in PPTG_10601-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	34	523	2.2e-71	0.9757281553398058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	3.27e-111	34	413	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	3.44e-06	450	527	18	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	4.30e-153	1	527	1	534
KAF3763706.1|GH140	2.32e-141	23	526	27	535
KAE8156220.1|GH140	1.71e-72	19	527	17	508
KAB8276359.1|GH140	2.54e-71	25	527	26	508
KAE8313632.1|GH140	3.56e-71	25	527	26	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.55e-24	23	526	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	3.00e-23	23	526	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PPTG_10601-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000516	0.999446	CS pos: 19-20. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10601-t26_1-p1.