CAZyme Information: PPTG_10577-t26_3-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10577-t26_3-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		86493.73	4.3725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669582:436606-439060(-)

Full Sequence      

MRMTGILAALIGTTVYQVDAAVNHYVLGTSFTVAVDVNATSVEVVNTAGDQVWKSASDRA
FVSASTGLTTITQSSGNFELNGDTVGTPIQNITIGDVTSTLRYVELSGSFDDSNWTWTLS
FSLDSDDSQTLKFNASVDGSDVANVYIAYESPLEEAFFGLGEQTGIGNLRGWRVPIWTRE
GGAGRGEEPITSVLNANPSVAGQFAGGSLLTTYTAVASLTSSLGRWIVLDGTNYVLFNLA
SNATTPFKDTAESFLAGDIVEGDHSNSFTTVQIQYEGSSVSGWLGRVTDGNVLLEATGAL
TEVTGRQPTLPDWVNDGAILGIQGGQEFVEGVIQDAQNTGLPLASVWLQDWSGTRLQAGS
YGIDVHRLWWNWEPDTTLYPTWAEWVPYLRKQYDVRTLSYVNTFLANVSTKSTGFNTNFY
EIAKREGRFVTNSTAGDDSVWTITSGVGIDAGILDLSKQTTISWFKDLVKQQFYSVPISG
GMQDFGEYLAVDDSVSLSSGTVNPRVFHNAYSTVWATILREVVEELGLTNETIGFHRSAG
TFSAKHTNIFWVGDQNIDASREDGLRAVVSSALHIGASGFGHTHSDVGGYTTILSAIGNL
TRNAALLGRWGELSAFSDAVFRTHEGNIPQVNVQAYTNASTLAYHAYNARLFRSLKNYRV
DLQAEYQTKGWPVLRHPIVYSPNDTTARSVIDESFWVGEALYVAPVYDVRATSLDVYLPP
IEINSEGHRVIGSGIRYKHLWSGEEFEPGQTVTVDTPWGQPGVFVRWPTSGEEESQLQDL
WTFVETEKSTVLTA

Enzyme Prediction     

No EC number prediction in PPTG_10577-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	290	766	3e-57	0.9742388758782201

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	1.03e-144	145	766	72	618	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	3.99e-144	305	649	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	2.63e-46	287	787	238	690	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.69e-33	290	766	5	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.16e-20	371	720	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW53386.1|GH31	3.87e-181	48	792	53	765
SMR41549.1|GH31	1.43e-177	49	792	52	763
SMQ45186.1|GH31	2.02e-177	49	792	52	763
SMY18900.1|GH31	2.02e-177	49	792	52	763
SMR43741.1|GH31	1.13e-176	49	792	52	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	3.64e-79	117	766	79	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
6PNR_A	1.09e-78	154	766	111	649	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5AEE_A	1.87e-78	117	766	79	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHY_A	9.38e-75	101	770	57	652	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	4.77e-74	101	770	57	652	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	1.58e-78	117	766	79	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|B3PEE6|OL4AG_CELJU	1.87e-09	301	719	250	633	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
sp|Q6NSJ0|MYORG_HUMAN	1.26e-06	445	719	427	678	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
sp|Q8BVW0|GANC_MOUSE	4.09e-06	420	719	433	723	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000313	0.999668	CS pos: 20-21. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10577-t26_3-p1.