CAZyme Information: PPTG_10366-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10366-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	KI669579|CGC3	87615.58	8.6603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669579:612805-615165(+)

Full Sequence      

MMLEVSPREACALLVFTAALITAWNANSNGFVWDDRSAVLANDDAQGSSLFEVFSHDFWG
THIRSMHSHKSYRPLTVLSFRLNYLLAKGHSAWLYHCTNALVHAGCSVLLWKVADVLFLQ
HHRRVETVPIKENPQDSFPVESDSRKSTANVGEWKILVGPLTSGLLFAVHPIHCDAVASI
VGRADLLCTSLSLLAFLAYTSGAKKSEKSWRFVVMALILTILAGLCKELGFTNFALLMVY
DLLRTHRLQNVEMGVQLMQKRLLITAITGIVAALVRVWINGEHRQMEWNILANNVVVQES
RLTRMLSYAHLHAWYLWKLVWPRWLCFDYGYNAIPVIESITDPRNVYTLIAYVVVAVGLR
SAILQLVGSRKTPPSSLYMMSIAFGVVPFVPASNVIFPVGTVVAERLLYFPSVGFCLLVG
CIIDRTFSIIDKHTVPSTLIGSSDTIQSVSSFTQPHNLFGAARFVVLICGTLILAAGCYR
SHLRNADWISEQTLFKAAVDVVPTNVKVLSNEAKNLLNSDPKRALDYLRIAIGMIPKHIE
SQTNAGLAFVTLASRNGLVMDLYLHGIRHLYKSAVLAPNHFQGVGFIGGEIYTHWMKKAR
LRNDDVTIGEFLGSESIAQATKFLDHSIDRNSVYPTHFYNRGSIAYESGDYDTAIRFFRM
TDVANGVIRDRKVDPELLVEASTIYNMLGVSYKKKGETDQALDVLRKGIKLYPEEIDLHI
NTALILHDVGNTDEARAQIKAGLAAAATRDYIPRLRNSAKLLENAKMTDVVKALLDHAAK
LERDCQ

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	82	248	1.3e-32	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	1.93e-21	299	356	17	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	5.09e-12	638	744	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	7.41e-07	684	780	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	1.00e-06	608	746	137	266	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	1.63e-06	617	710	17	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
Q5T4D3|GT105|2.4.1.109	3.05e-65	4	524	15	500
BAF83034.1|GT105|2.4.1.109	3.89e-64	4	524	15	500
BAC25886.1|GT105	1.06e-61	4	529	14	506
BAC32288.1|GT105	1.06e-60	4	529	14	506
BAC28522.1|GT105	1.06e-60	4	529	14	506

PDB Hits     

PPTG_10366-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	5.41e-66	4	524	15	500	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	1.88e-61	4	529	14	506	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q8BRH0|TMTC3_MOUSE	3.56e-56	2	580	6	532	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	1.73e-54	14	580	9	527	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	1.86e-54	13	552	38	561	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.254183	0.745793	CS pos: 26-27. Pr: 0.5430

TMHMM  Annotations     

Start	End
10	32
210	232
262	279
346	368
378	400
407	429
459	478