CAZyme Information: PPTG_10340-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10340-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	KI669579|CGC5	36547.19	8.5231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669579:556778-557794(+)

Full Sequence      

MSILALFSALAGVIATAEGACTGPNTRTMPPPGAIVVDATGVYNGSFKTVSEGVTKLSTS
TGDHTLFLMPGTYKEKVIIPQLKGKLIVQGYTCDTTSYASNQVTITHAMAQRDVPASITK
NRNDYTTTLLLKSSNVKVYNLNVANTAGNVGQAIAMKVDGANYGIYACKITGYQDTLYAN
NGPALFAKSYISGAIDFVFGLYAKAWFESCDIESVGYGCVTANGRTDNSNPSEYVFNNVR
VFGSKPEQAFLGRPWRPYARVVFQNSDLSDVINPEGWQKWNGDNNTANVYFKEYKNRGAG
AATNKRVAFSGTLQSPVTITEILGSDFNSAWWVDKSFM

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	36	312	2.1e-73	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	8.29e-47	23	315	1	274	putative pectinesterase
395871	Pectinesterase	5.47e-46	35	311	2	276	Pectinesterase.
178113	PLN02497	2.93e-44	35	335	34	328	probable pectinesterase
215173	PLN02304	2.64e-43	29	313	66	354	probable pectinesterase
215117	PLN02176	4.00e-41	35	309	41	309	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM08806.1|CE8	1.39e-213	1	338	1	338
ACO54869.1|CE8	2.84e-206	1	338	1	338
ACO54873.1|CE8	1.95e-159	10	338	11	344
ABQ63096.1|CE8	7.92e-159	10	338	11	344
ACO54875.1|CE8	3.46e-153	7	338	4	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	8.98e-60	26	337	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.27e-59	26	337	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.55e-35	35	311	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.59e-33	35	311	7	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.42e-09	167	305	172	339	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	5.43e-78	26	338	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.54e-77	26	337	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	2.83e-67	25	337	26	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	7.97e-67	8	337	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	7.97e-67	8	337	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000625	0.999342	CS pos: 19-20. Pr: 0.9361

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10340-t26_1-p1.