CAZyme Information: PPTG_10339-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10339-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	KI669579|CGC6	42145.72	9.2814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669579:550858-552095(+)

Full Sequence      

MPSHAVQYATKGSISSHTHRARFVTLCTVIRCCRPYSNFSSKPLKPQQLMQTLALLFALA
GVIATAEGACTGPNTRTMPPPGAIVVDATGVYNGSFKTVSEGVTKLSTSTGDHTLFLMPG
TYKEKVIIPQLKGKLIVQGYTCDTTSYASNQVTITHAMAQRDVPASITKNRNDYTTTLLL
KSSNVKVYNLNVANTAGNVGQAIAMKVDGANYGIYACKITGYQDTLYANNGPALFAKSYI
SGAIDFVFGLYAKAWFESCDIESVGYGCVTANGRTDNSNPSEYVFNNVRVFGSKPEQAFL
GRPWRPYARVVFQNSDLSDVINPEGWQKWNGDNNTANVYFKEYKNRGAGAATNKRVAFSG
TLQNPVTITEILGSDFNSAWWVDKSFM

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	85	361	3.8e-73	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	7.85e-47	72	364	1	274	putative pectinesterase
395871	Pectinesterase	3.78e-46	84	360	2	276	Pectinesterase.
178113	PLN02497	1.90e-43	84	384	34	328	probable pectinesterase
215173	PLN02304	4.58e-43	78	376	66	367	probable pectinesterase
215117	PLN02176	2.12e-41	84	358	41	309	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM08806.1|CE8	7.10e-215	50	387	1	338
ACO54869.1|CE8	4.14e-207	50	387	1	338
ACO54873.1|CE8	2.19e-159	50	387	1	344
ABQ63096.1|CE8	8.86e-159	50	387	1	344
ACO54875.1|CE8	3.83e-153	54	387	6	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.04e-58	74	386	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.46e-58	74	386	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.81e-34	84	360	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.74e-32	84	360	7	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	2.60e-09	216	354	172	339	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	3.72e-77	75	387	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.95e-76	75	386	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	3.21e-67	50	386	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.52e-66	54	386	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.52e-66	54	386	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.961622	0.038362

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10339-t26_1-p1.