CAZyme Information: PPTG_10338-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_10338-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	KI669579|CGC2	38771.72	6.6982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669579:549060-550139(+)

Full Sequence      

MPDRWVIHFLFPPSPLKSQRTMQIFAPLVALAGLVAAAEGACTGPNARTTPPPGAVVVDA
TGAYNGSFKTVSEGVAKLSNTTAPHILFLMPGTYEEQVTIPKIKGNLVVQGYTCDTTSYA
ANEVTITHAMAQKDVPANITKSRNDYTATLLLKASNVKMYNLNVANTAGNIGQAIAMKVD
GANYGIYACNLTGYQDTLYANKGPELFAKSYINGAVDFVFGLYAKAWFESCDIESVGKGC
ITANGRTNDSNPSEYVFNNARVFGSNPGQAFLGRPWRPYARVVFQNSNLSDVINPAGWQQ
WNGDNNTANLYFKEFNNIGAGAATDQRVGFSGTLEKPVAITEILGESYESAWWVDKSFM

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	57	333	1.1e-75	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	7.74e-52	56	332	2	276	Pectinesterase.
178051	PLN02432	2.16e-46	56	334	13	272	putative pectinesterase
178113	PLN02497	2.95e-45	56	334	34	306	probable pectinesterase
215173	PLN02304	3.34e-45	51	334	67	354	probable pectinesterase
215117	PLN02176	1.49e-43	56	328	41	307	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	7.90e-230	22	359	1	338
AFM08806.1|CE8	4.53e-213	22	359	1	338
ACO54873.1|CE8	1.27e-165	22	359	1	344
ABQ63096.1|CE8	5.14e-165	22	359	1	344
ACO54875.1|CE8	7.85e-160	22	359	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.45e-62	46	358	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.37e-61	46	358	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.61e-39	56	332	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	6.98e-35	66	332	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	2.16e-77	48	359	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.09e-74	48	358	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B8NPS7|PMEA_ASPFN	3.39e-65	48	358	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	9.53e-65	48	358	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	9.53e-65	48	358	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.158507	0.841473	CS pos: 40-41. Pr: 0.7280

TMHMM  Annotations     

There is no transmembrane helices in PPTG_10338-t26_1-p1.