CAZyme Information: PPTG_09841-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_09841-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: CMGC/CDK protein kinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1788		201885.96	7.2919

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669581:496800-503446(-)

Full Sequence      

MTFGRRIAVAALCSTVLFTLTDAWLPPIITKGNKFFDSKTGLEFRMKGMAYYPRPNSGEM
ADVGNYDWAADEHEDVWQPHLEVMKDLGVNTIRLYSVDPSVSHDKFMCACSEAGIYVLVG
VTAPCKNCSVQDHVPPTCYPAELFTRGQMVYNAFAVYDNTLGFSVGNENNLQVENGADGT
TTAPCVKAFLRDMRSYAASCSAAVRQVPMGLDIADIPPRWQWISYYDCAVDNDENSRAEW
MGFNPYVECDPATHTKYSQSSGLKTLMDEYAEVKYARPLMFGEFGCNKGENTIDGYENQR
DSPDALPETTSFDQLQALRNVQLIERNEYPLKHLARDKVRRRSRRDEDEDEEEGALCFCT
FPDAAEREEAEQKGEPVRRCDDVSCLNFATYVECTASCPTGQYCRNQRLQHPERYPHLEP
FKTEHKGYGVRTRQHIPQLSIVGEYVGEIIDQKELARRLKSVPRHELNFYYLLLAPGVYI
DARNKGSFTRFVNHSCEPNCKTEKWTVKGETRIAVSALRDIEVGEELTFDYKWKALGSRQ
IKCFCGAPSCKGVIGTQNETLQNAEAQTGYFRDPEKQEIGNALVGRRVRVFLSPEDKTEY
DVQLIKGYDEQKDRYEVEDLLEPGGYETDENDTEEEQDATEKQYVQLKENGWQLYCPPGD
KEGGQVFAIPKRRIPVTNADSRDPSPKKETMTPSPVRTPSPVATARLENNFNTQKRNEYG
ELLDREGKVVSNKLLVKFLPKEYDERGLRSLFISRKHPHALVSADVFHFLDGTGWALVEL
ENYELASSFRRTLDRRNLLDKMLRVYQAGTKELDNFRHQKTKVQMMRQAGITSSSLASEE
KENVQEKKIDPYCFGRKLNWLVTEDELKNLSVQQVLSASLEETLRVKYVKSIFHIAKGLR
LDREDATSAIIALNRYFTFHTMPMEVDIYAATMLHLFLKAHARKVPWTAFVKEVYKAKHG
LSAAERLTAASPELGVLKRHLVKAESELLEGLHYDVTGEDPYALLDLLTTRKSSKKLVAL
SQNGYGHHITPFLSSLPPPEVQKEAKHLVAEALPLPIWRHTPVECVMLSVVYVSAAVTEA
LSSRPAPFICKIPDFLPQLDLQTNASEARMLLDCSLSICTQLKDRWVRLEKQSKSAQQKQ
PKDANAPDFDMTQFDVSKDKKDVYISERIARLLKQWINLPAPSLSSALGAVSTVSATGMG
NFPTVSPSHNTGKRCITFKEMGSSVPIPSSTSQTSDNLGIVSALSISPKKSASGTNDSNV
GDVRIHTDEIVKVESIRKRAFLGVISSDVGFDLAGKPVYLQSWPYLEQELFFTEEKGINE
ACLRELSAATTLSSLLPDRFMKLHGIIFPADRKDRQASESKTGKNSDVDELDLLAATIDD
DGNPLPEGIDRLARQKHYLAFEQPLHMFSGIFEAHVPLSSTLRKKAIFDMLQSLAAVHDQ
GYVHRFIAPSHLLVFKNGIKLGGFHSMRKIANIKPKDGEGSTIAGYEMSDSERKEHCYGA
WLYVTAPEVLLGETKYTWRSDVWSAGCVVLAILLEKIPFLQGQDVKVQLDLIYRLCGTPS
MSWEGAHKLPLYNAFRPKHEYKMRLRKTLLEQRSKFPDFPEDAVEVLEAMLQLDPARRST
VKKLLDMRYFDSVRSGERTFDFSDLPSTFPVQKKKLVQHLLKAKAKKHRSAGSRSTSSRS
SHHHRHSEHRHKRSLSTHDGLVEKSSHHDRHKSRSDKRKSRSLSTSRRDVKHADTEDSEM
QDVSEYVPLPASFTASAGSSPSRSTDDSLPPREKRMKLGWGMGLNSVS

Enzyme Prediction     

No EC number prediction in PPTG_09841-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	25	289	9.2e-66	0.7852564102564102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.79e-54	17	288	1	251	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
380950	SET_NSD	6.60e-54	415	555	1	142	SET domain (including post-SET domain) found in nuclear SET domain-containing proteins, NSD1, NSD2, NSD3 and similar proteins. The nuclear receptor-binding SET Domain (NSD) family of histone H3 lysine 36 methyltransferases is comprised of NSD1, NSD2, and NSD3, which are primarily known to be involved in chromatin integrity and gene expression through mono-, di-, or tri-methylating lysine 36 of histone H3 (H3K36), respectively. NSD1 (EC 2.1.1.43; also termed histone-lysine N-methyltransferase H3 lysine-36 and H4 lysine-20 specific, androgen receptor coactivator 267 kDa protein (ARA267), androgen receptor-associated protein of 267 kDa, H3-K36-HMTase, H4-K20-HMTase, lysine N-methyltransferase 3B (KMT3B) or NR-binding SET domain-containing protein 1) functions as a histone-lysine N-methyltransferase that preferentially methylates 'Lys-36' of histone H3 and 'Lys-20' of histone H4. NSD2 (EC 2.1.1.43; also termed multiple myeloma SET domain-containing protein (MMSET), protein trithorax-5 (TRX5), or wolf-Hirschhorn syndrome candidate 1 protein (WHSC1)) acts as histone-lysine N-methyltransferase with histone H3 'Lys-27' (H3K27me) methyltransferase activity. NSD3 (EC 2.1.1.43; also termed protein whistle, WHSC1-like 1 isoform 9 with methyltransferase activity to lysine, Wolf-Hirschhorn syndrome candidate 1-like protein 1 (WHSC1L1), or WHSC1-like protein 1) functions as a histone-lysine N-methyltransferase that preferentially methylates 'Lys-4' and 'Lys-27' of histone H3.
380951	SET_ASH1L	5.11e-53	417	556	1	141	SET domain (including post-SET domain) found in ASH1-like protein (ASH1L) and similar proteins. ASH1L (EC 2.1.1.43; also termed absent small and homeotic disks protein 1 homolog, KMT2H, or lysine N-methyltransferase 2H) acts as histone-lysine N-methyltransferase that specifically methylates 'Lys-36' of histone H3 (H3K36me). It plays important roles in development; heterozygous mutation of ASH1L is associated with severe intellectual disability (ID) and multiple congenital anomaly (MCA).
380929	SET_SETD2-like	9.20e-53	418	551	2	136	SET domain (including post-SET domain) found in SET domain-containing protein 2 (SETD2), nuclear SETD2 (NSD2), ASH1-like protein (ASH1L) and similar proteins. This family includes SET domain-containing protein 2 (SETD2), nuclear SETD2 (NSD2) and ASH1-like protein (ASH1L), which function as histone-lysine N-methyltransferases. SETD2 specifically trimethylates 'Lys-36' of histone H3 (H3K36me3) using demethylated 'Lys-36' (H3K36me2) as substrate. NSD2 shows histone H3 'Lys-27' (H3K27me) methyltransferase activity. ASH1L specifically methylates 'Lys-36' of histone H3 (H3K36me). The family also includes Arabidopsis thaliana ASH1-related protein 3 (ASHR3) and similar proteins.
380949	SET_SETD2	4.99e-52	415	555	1	142	SET domain (including post-SET domain) found in SET domain-containing protein 2 (SETD2) and similar proteins. SETD2 (also termed HIF-1, huntingtin yeast partner B, huntingtin-interacting protein 1 (HIP-1), huntingtin-interacting protein B, lysine N-methyltransferase 3A or protein-lysine N-methyltransferase SETD2) acts as histone-lysine N-methyltransferase that specifically trimethylates 'Lys-36' of histone H3 (H3K36me3) using demethylated 'Lys-36' (H3K36me2) as substrate. It has been shown that methylation is a posttranslational modification of dynamic microtubules and that SETD2 methylates alpha-tubulin at lysine 40, the same lysine that is marked by acetylation on microtubules. Methylation of microtubules occurs during mitosis and cytokinesis and can be ablated by SETD2 deletion, which causes mitotic spindle and cytokinesis defects, micronuclei, and polyploidy.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24052.1|GH72	0.0	8	1788	505	2516
AIG56180.1|GH72	5.91e-103	19	312	37	335
AIG55825.1|GH72	2.43e-101	22	300	24	302
AIG55538.1|GH72	7.21e-97	24	300	25	301
CCA15748.1|GH72	9.68e-93	23	305	2186	2463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J9J_A	3.77e-46	323	558	29	247	crystal structure of SESTD2 in complex with H3.3S31phK36M peptide [Homo sapiens]
7EA8_L	6.67e-46	323	558	24	242	Chain L, Histone-lysine N-methyltransferase SETD2 [Homo sapiens]
4FMU_A	1.74e-45	323	558	42	260	Crystal structure of Methyltransferase domain of human SET domain-containing protein 2 Compound: Pr-SNF [Homo sapiens],4H12_A The crystal structure of methyltransferase domain of human SET domain-containing protein 2 in complex with S-adenosyl-L-homocysteine [Homo sapiens],7LZB_A Chain A, Histone-lysine N-methyltransferase SETD2 [Homo sapiens],7LZD_A Chain A, Histone-lysine N-methyltransferase SETD2 [Homo sapiens],7LZF_A Chain A, Histone-lysine N-methyltransferase SETD2 [Homo sapiens]
5JJY_A	1.79e-45	323	558	43	261	Crystal structure of SETD2 bound to histone H3.3 K36M peptide [Homo sapiens],5JLB_A Crystal structure of SETD2 bound to histone H3.3 K36I peptide [Homo sapiens],5JLE_A Crystal structure of SETD2 bound to SAH [Homo sapiens]
5LSS_A	2.80e-45	323	558	59	277	Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LSX_A Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LSY_A Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LSZ_A Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LT6_A Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LT6_B Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LT7_A Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],5LT8_A Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives [Homo sapiens],6VDB_A SETD2 in complex with a H3-variant peptide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9Q5F9|SETD2_MOUSE	2.37e-40	323	583	1449	1693	Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
sp|Q9BYW2|SETD2_HUMAN	3.12e-40	323	583	1475	1719	Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
sp|O88491|NSD1_MOUSE	3.55e-39	382	574	1806	2001	Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
sp|Q9VW15|ASH1_DROME	9.77e-39	373	589	1347	1557	Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
sp|Q96L73|NSD1_HUMAN	1.39e-38	382	557	1908	2084	Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000636	0.999329	CS pos: 23-24. Pr: 0.9725

TMHMM  Annotations     

Start	End
7	29