CAZyme Information: PPTG_09705-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_09705-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	KI669578|CGC3	36852.12	4.6185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669578:995315-996346(-)

Full Sequence      

MQIFTPLVAFAGLAAGALADRACSGPNARTEPPAGAIVVDATGAYKNSFRTVSEGVARLD
PNTTSEQTVFVRPGVYNEQVLISPLSGPLVLQGFTCDAMSYAGNEVTITQAKAQKDIPAE
VTGEARNDMTSTVRFKSDNVKVYNLNIANTAGNVGQALAVNVNATDYGFYACNLTGYQDT
VLADKGRELYARTYINGATDFIFGRYAQAWFESCDIETIGTGFITASGRESESSTATYVI
NRARVFGKSGVNSTVLGRPWRPYAKVIWQNSELGDVVKPEGWATWDATSPTDKVIFKEFN
NSGPGANTANRVAFSGQLDAPVAITEVLGEGYATEWWVDTKYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	38	319	5.2e-71	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	3.05e-46	33	318	9	272	putative pectinesterase
178113	PLN02497	8.01e-44	34	339	31	327	probable pectinesterase
395871	Pectinesterase	5.56e-41	37	316	2	276	Pectinesterase.
178372	PLN02773	3.33e-39	32	318	2	282	pectinesterase
215117	PLN02176	1.36e-38	27	314	31	309	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54868.1|CE8	1.60e-226	1	343	1	343
ACO54869.1|CE8	2.88e-156	1	343	1	338
ABQ63096.1|CE8	7.42e-156	1	343	1	344
ACO54873.1|CE8	2.12e-155	1	343	1	344
AFM08806.1|CE8	1.15e-148	1	343	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	5.99e-62	29	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.45e-62	29	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	5.45e-31	37	316	11	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.29e-30	37	316	7	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	9.90e-13	47	316	46	340	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.14e-78	29	342	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	4.08e-76	29	343	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B8NPS7|PMEA_ASPFN	1.66e-67	29	342	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.35e-67	29	342	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	6.61e-67	29	342	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999703	CS pos: 19-20. Pr: 0.9702

TMHMM  Annotations     

There is no transmembrane helices in PPTG_09705-t26_1-p1.