CAZyme Information: PPTG_09699-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_09699-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	KI669578|CGC1	36451.57	6.8813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669578:979338-980327(-)

Full Sequence      

MDSETNQKWMYDSASGQLKHVKHQGLCLDQDAGQGNKLHLYGCSPNNPNQQWGIMDPNDI
TDGWTFSDGSVRFYTMESSKPFAQLVRNGDNVAIAFGGNNVAGSQWYYDASTHLVKAKVS
NMCLDAYQPWDGGIVHVYACNVNEANQHWNLDSTTNQLKHLKHNGFCLDADLSANNGAGK
LQLWGCHLNNNNQVWRMIPATAVAATVHGSSVINAYLQPAPQDKIVGAVSTGKWEQHWFW
DANSNHLISKINGQCLDAYEAWNGGRVHTYACIATEGNQKWSYDATNQMIKHVKHAGFCL
AFDNASNKLMKLKSCNTGDNTQRIIIEAA

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	87	205	1.1e-16	0.6276595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.18e-16	14	195	1	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.19e-14	162	323	8	125	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	3.86e-13	115	281	5	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.35e-10	16	197	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	2.45e-10	120	240	9	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55595.1|CBM13|GH17	4.76e-37	32	316	234	544
AIG55540.1|CBM13	6.46e-36	105	320	377	586
AIG55751.1|CBM13|GH3	4.96e-32	98	316	785	1006
AIG56230.1|CBM13|GH17	4.77e-30	32	321	188	497
AIG56282.1|CBM13	1.34e-28	71	306	332	558

PDB Hits     

PPTG_09699-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_09699-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_09699-t26_1-p1.