CAZyme Information: PPTG_09460-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_09460-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		44578.18	7.7110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669578:368219-369457(-)

Full Sequence      

MGRLQLAIAAALTVLVTGASAFTVGSPPGLAAGTTGGANGTVVYPNTIEELMGYLNASEP
LVVVLNKTFDFRGTEGTTTEIGCRPQGARNCIAANTGFKSQDVILTNGMNNTGGCTNGTE
TIVTYDNAFRWRMNVTSHKTIRGIGRRGVIMGKGMTLKGDNIIVQNIHITELNRHLVWGG
DALFMEGTMNATRTMNNIWIDHVKVSRVGRQMLVVNKAGVATLTVSNSDFDGETDYSASC
NGRHYWTILLYGKKVGVSLLNNYVHSTAGRSPKVGDKNSSVIAHVANNYWDNIANHSFEL
DGNAWMLAEGNYFNSVKNPLYRKGQGFLYAATGVDECMEYLGRPCEENILVNSGNFTSRN
GTAALEAMKPYSAITNYSPVKHSQSEQQWTQASDIDKVWAQTTGNFGIGNLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	314	3.1e-75	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.62e-30	122	313	3	186	Amb_all domain.
226384	PelB	1.88e-15	1	320	1	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.84e-05	134	313	31	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	3.07e-184	1	412	1	441
ADN18835.1|PL1_4	1.24e-183	1	412	1	441
AHX74068.1|PL1_4	1.49e-167	10	412	10	400
ADN18834.1|PL1_4	3.46e-166	10	412	10	400
ADN18833.1|PL1_4	3.12e-157	1	412	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.06e-72	25	411	5	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	1.47e-69	24	357	4	323	Pectin Lyase B [Aspergillus niger]
1IDJ_A	2.07e-69	25	411	5	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	6.37e-84	24	358	24	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	3.29e-83	24	411	24	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	3.29e-83	24	411	24	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	5.34e-81	25	358	24	342	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1
sp|A1DEH0|PELF_NEOFI	7.53e-80	25	411	20	386	Probable pectin lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999759	CS pos: 21-22. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in PPTG_09460-t26_1-p1.