CAZyme Information: PPTG_08767-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_08767-t26_1-p1
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	KI669576|CGC2	61695.73	8.8351

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669576:316906-318543(-)

Full Sequence      

MPASECGTRIRDSRFLSNVYIRGLGAFMLFCGVCSLSQQYAFVSDGGLSERYNLRSATMQ
KAFSLAAQNTPDVDPKESWSLKASASTDNTSTSVEPQPTTQLPISTTVAPTTAPTEKPTA
KPTEKPTPKPTEKPTEKPTEKPKRVAEPRQVIKKGSKGILLCLHDGILELGISLIRELRC
LGNKEPIEVHHCHDLTRPSVDLLFGLDDNIQVIDLCERYVNKKILSDELAKSFQSYWIKP
LAVHFTSFEELIFLDADAILLKDPAVLRNNEGYKKNGTLFFYDRVINNNQYLNKKTDKGP
IYLHQWLKSFDYKRFGLAYADPSPAFKKSFAYRGKTAHEQDSSMLLINKRNAEKAMSVLW
FLITEHRFIYEFSWGDKEAFWLSYELSHTPYFFSPWGASVVSDISNKDMERHPDTLCGSL
AHFDPTLNASAPAELLYVNGRSLVDPVPFRLHKLKLLQPNLVFNMMPTHVTPRQARREPS
GKGEWPECLTGMGSTPVPRQLLPNLWRRRQHFQAISMGFIEPLLECNNPGDRLPEIPEAS
KKAKK

Enzyme Prediction     

No EC number prediction in PPTG_08767-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	157	424	1.1e-47	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.29e-31	156	424	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
282710	PT	3.03e-06	116	143	8	35	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.
236940	PRK11633	3.39e-05	83	148	74	129	cell division protein DedD; Provisional
282710	PT	3.49e-05	91	140	1	36	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.
236768	PRK10819	2.57e-04	94	150	72	125	transport protein TonB; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22801.1|GT71	6.61e-118	156	527	58	431
CCA15193.1|GT71	2.67e-115	156	526	131	515
BAP68847.1|GT71	5.70e-92	156	445	65	365
AIG56246.1|GT71	7.83e-66	156	497	64	435
AIG56397.1|GT71	1.35e-63	156	511	91	453

PDB Hits     

PPTG_08767-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53745|MNT4_YEAST	1.68e-17	152	440	193	482	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|P53059|MNT2_YEAST	2.11e-17	151	440	169	460	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	5.31e-14	156	423	275	524	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|Q5AGA9|MNN13_CANAL	1.75e-13	156	411	331	604	Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN13 PE=2 SV=2
sp|Q59VL7|MNN15_CANAL	2.62e-11	148	412	254	548	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.681795	0.318212

TMHMM  Annotations     

Start	End
20	42