CAZyme Information: PPTG_08452-t26_9-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_08452-t26_9-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein, variant 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		53355.49	5.6960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669574:350587-352341(-)

Full Sequence      

MLYVRALPSDLRRWQMENWTWEKALDIYLSIEDFDGPNSSYHSKQGFIRTSPPALALDMS
REFIEACVELGIPRTADFNAPDGRYGAGYYHFNTRDGVRESAAKAFLGPILDSKTAESKR
ENFRLMLDTTVTRISINDDNVTEGVEVRFGNDTGQLIRLAEHGEVIVTAGAINTPKILML
SGLGNQDALKKAGLPLKKHLPRVGMNLQDHPVIGMVFEYKSPRVVDLKADLDSYFTATNA
KHTNVSSFGLFGSAGLSTGAFLIPPGATLPEIQLTLFPRKSEPHMSNSAGLDHMTEVVVT
IALLHPLARSRVVLIHDENDYVDDNDIDDHLIPRVVSEIPDAKPEHLRHGDVWKISWAIG
VVREIAAKLAEKKLIGRELSPGAEITSPKDLNDWVFDNVFRNSHWVGSASMANSEEEGVV
DNHLRVFGIQNLRVADASVIPLIPNGNVHSTVVMVANRAAQILREDEAEYRRQYDHEVII

Enzyme Prediction     

No EC number prediction in PPTG_08452-t26_9-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	466	3.2e-85	0.8380281690140845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.87e-72	1	466	96	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.20e-67	1	464	97	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	4.20e-26	1	212	36	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.80e-25	351	459	30	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.15e-11	116	465	228	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	9.81e-271	1	474	177	650
BDA51473.1|AA3	4.81e-43	2	463	139	600
AFP03409.1|AA3_2	7.49e-43	19	464	3	417
CAB3230510.1|AA3_2	3.69e-42	1	467	121	559
AWP09430.1|AA3_2	9.01e-42	1	464	116	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.63e-42	2	463	97	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.24e-42	2	463	97	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.24e-42	2	463	97	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.24e-42	2	463	97	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.71e-42	2	463	113	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8D3K2|BETA_VIBVU	2.08e-44	1	463	94	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	5.46e-44	1	463	94	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	8.01e-43	1	468	137	576	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|A8JHB7|FAP_CHLRE	3.47e-42	2	464	136	597	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|A0A248QE08|FAP_CHLVA	2.58e-41	2	463	173	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_08452-t26_9-p1.