CAZyme Information: PPTG_08452-t26_4-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_08452-t26_4-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		72771.09	6.6379

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669574:350587-352954(-)

Full Sequence      

MAASYSDERSPLLRPGVQRIGRRTRLLVSGLALLLLFAGGAACVAIVLRLLRPGALSTIT
PLVLSEEYDAIVIGGGPAGSVVAKLLSDDPWRRVLLVEAGNASQTQLGGKVGRLNLCKNS
WRSNLRNLILQDAIPSPLNSKKLTPFDVPFYWTNVANTPSLHWAYPDVNVAKALGGCGIH
NAMLYVRALPSDLRRWQMENWTWEKALDIYLSIEDFDGPNSSYHSKQGFIRTSPPALALD
MSREFIEACVELGIPRTADFNAPDGRYGAGYYHFNTRDGVRESAAKAFLGPILDSKTAES
KRENFRLMLDTTVTRISINDDNVTEGVEVRFGNDTGQLIRLAEHGEVIVTAGAINTPKIL
MLSGLGNQDALKKAGLPLKKHLPRVGMNLQDHPVIGMVFEYKSPRVVDLKADLDSYFTAT
NAKHTNVSSFGLFGSAGLSTGAFLIPPGATLPEIQLTLFPRKSEPHMSNSAGLDHMTEVV
VTIALLHPLARSRVVLIHDENDYVDDNDIDDHLIPRVVSEIPDAKPEHLRHGDVWKISWA
IGVVREIAAKLAEKKLIGRELSPGAEITSPKDLNDWVFDNVFRNSHWVGSASMANSEEEG
VVDNHLRVFGIQNLRVADASVIPLIPNGNVHSTVVMVANRAAQILREDEAEYRRQYDHEV
II

Enzyme Prediction     

No EC number prediction in PPTG_08452-t26_4-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	67	647	1e-102	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.72e-86	65	648	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.80e-78	65	646	3	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.37e-28	171	394	24	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.00e-25	533	641	30	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.50e-14	66	647	54	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	0.0	1	656	18	650
QWC20507.1|AA3_2	1.22e-59	66	650	4	529
BDA51473.1|AA3	1.16e-53	65	645	47	600
CAB3230510.1|AA3_2	3.63e-52	48	649	7	559
AWP09430.1|AA3_2	1.32e-48	63	646	15	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.01e-50	63	645	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.31e-50	56	645	12	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	1.39e-50	63	645	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.39e-50	63	645	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.39e-50	64	645	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8D3K2|BETA_VIBVU	1.69e-52	64	645	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	4.18e-52	66	650	39	576	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q7MF12|BETA_VIBVY	4.41e-52	64	645	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.35e-50	68	645	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	9.99e-50	66	646	44	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000038

TMHMM  Annotations     

Start	End
26	48