CAZyme Information: PPTG_08452-t26_3-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_08452-t26_3-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein, variant 9

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		51469.24	5.4338

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669574:350587-352229(-)

Full Sequence      

MENWTWEKALDIYLSIEDFDGPNSSYHSKQGFIRTSPPALALDMSREFIEACVELGIPRT
ADFNAPDGRYGAGYYHFNTRDGVRESAAKAFLGPILDSKTAESKRENFRLMLDTTVTRIS
INDDNVTEGVEVRFGNDTGQLIRLAEHGEVIVTAGAINTPKILMLSGLGNQDALKKAGLP
LKKHLPRVGMNLQDHPVIGMVFEYKSPRVVDLKADLDSYFTATNAKHTNVSSFGLFGSAG
LSTGAFLIPPGATLPEIQLTLFPRKSEPHMSNSAGLDHMTEVVVTIALLHPLARSRVVLI
HDENDYVDDNDIDDHLIPRVVSEIPDAKPEHLRHGDVWKISWAIGVVREIAAKLAEKKLI
GRELSPGAEITSPKDLNDWVFDNVFRNSHWVGSASMANSEEEGVVDNHLRVFGIQNLRVA
DASVIPLIPNGNVHSTVVMVANRAAQILREDEAEYRRQYDHEVII

Enzyme Prediction     

No EC number prediction in PPTG_08452-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	451	3.1e-82	0.8028169014084507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.11e-67	2	451	116	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.03e-63	1	449	116	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.16e-25	336	444	30	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.29e-23	2	197	56	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.45e-11	101	450	228	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	1.17e-260	1	459	192	650
QWC20507.1|AA3_2	4.99e-46	2	453	113	529
AFP03409.1|AA3_2	2.08e-43	4	449	3	417
BDA51473.1|AA3	7.11e-40	4	448	156	600
CAB3230510.1|AA3_2	3.02e-39	2	452	140	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.80e-39	1	448	111	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.46e-39	1	448	111	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.46e-39	1	448	111	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.46e-39	1	448	111	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.91e-39	1	448	127	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8D3K2|BETA_VIBVU	9.42e-42	2	448	113	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	2.46e-41	2	448	113	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|A8JHB7|FAP_CHLRE	3.68e-39	1	449	150	597	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.50e-38	4	453	158	576	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|A0A248QE08|FAP_CHLVA	2.53e-38	1	448	187	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_08452-t26_3-p1.